DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Srpk79D and SRPK2

Sequence 1:NP_001246881.1 Gene:Srpk79D FlyBaseID:FBgn0025702 Length:1018 Species:Drosophila melanogaster
Sequence 2:XP_024302662.1 Gene:SRPK2 HGNCID:11306 Length:767 Species:Homo sapiens

Alignment Length:772 Identity:287/773 (37%)
Similarity:396/773 (51%) Gaps:157/773 (20%)


  Fly   305 DEIYPDSSDSSLYVSDEEQEDASQYCRGGYHPVVIGDIFDNRFRVVRKLGWGHFSTVWLCRDLKD 369
            |...|:..:..|...||||||.:.||:||||||.|||:|:.|:.|:||||||||||||||.|::.
Human    87 DPTPPEPEEEILGSDDEEQEDPADYCKGGYHPVKIGDLFNGRYHVIRKLGWGHFSTVWLCWDMQG 151

  Fly   370 EKYVALKVVKSAPHYIETAADEIRLLEAIRDADPMDVKRERIVRLMNHFTVRGVNGMHTCLVFEA 434
            :::||:||||||.||.|||.|||:||:.:|::||.|..::.:|:|::.|.:.|:||:|.|:|||.
Human   152 KRFVAMKVVKSAQHYTETALDEIKLLKCVRESDPSDPNKDMVVQLIDDFKISGMNGIHVCMVFEV 216

  Fly   435 LGCSLYKLIVKNNYQGLAIAQVRNIIRQVLEGLDYLHSKCSIIHTDIKPENILLVIDNAAAMNQQ 499
            ||..|.|.|:|:|||||.:..|::||||||:|||||||||.||||||||||||:.:|:|..  ::
Human   217 LGHHLLKWIIKSNYQGLPVRCVKSIIRQVLQGLDYLHSKCKIIHTDIKPENILMCVDDAYV--RR 279

  Fly   500 IDDEINSLRVKGVDFPDSYISSIEKQTKSRAKWPLIEPNGSTNTNTNTSNSTATNSNSSTPLAAV 564
            :..|....:..|...|.....|...|.|         |.|..:.|............     |.:
Human   280 MAAEATEWQKAGAPPPSGSAVSTAPQQK---------PIGKISKNKKKKLKKKQKRQ-----AEL 330

  Fly   565 IMSTLD--KEDTTTTTSSTLNSNTTSSLASKYSSLLGDSECNGGLGGSANINNRYRTEKKI---- 623
            :...|.  :|.........:..|.||:..|.                  :.:..|..|.|:    
Human   331 LEKRLQEIEELEREAERKIIEENITSAAPSN------------------DQDGEYCPEVKLKTTG 377

  Fly   624 --------TAKSSGDCD-----EDAESDTLGEQSTLASTMDSPTDLDPE-----PELDSKPNTVP 670
                    |||.:|:.:     ||||.:.:.:..         .|:|.|     |.....|.|..
Human   378 LEEAAEAETAKDNGEAEDQEEKEDAEKENIEKDE---------DDVDQELANIDPTWIESPKTNG 433

  Fly   671 EPSEGPIP-EQPTPNSTN--SSCPSHNTATIAKSKINSNILSTCTSLTSTNEYCFTNT-NTTTAS 731
            ....||.. ||...:..:  ..||:.....:.:....|             :|.:::: ......
Human   434 HIENGPFSLEQQLDDEDDDEEDCPNPEEYNLDEPNAES-------------DYTYSSSYEQFNGE 485

  Fly   732 TPSA----PPSATPSSAPALASAT-PPSTCTPSFTQIAPSATAPATSTTCTTSAEFYDGDHKTTS 791
            .|:.    |.|..|..:.:|.|.: .|..|....::.:|           .|..|.....|..:.
Human   486 LPNGRHKIPESQFPEFSTSLFSGSLEPVACGSVLSEGSP-----------LTEQEESSPSHDRSR 539

  Fly   792 TSTTTTSNAISSATTTTATTTTAIAKLNVHANAIPSQNQSQSSQNNTYTIQSLIDNSNVRVKIAD 856
            |.:.:::..:..|.|..|         ::..|.:..:|..:                 :||||||
Human   540 TVSASSTGDLPKAKTRAA---------DLLVNPLDPRNADK-----------------IRVKIAD 578

  Fly   857 LGNACYDYHHFTEDIQTRQYRSIEVLLGAPYNYTADIWSTACLAFELATGDYLFDPHAGESYSRD 921
            |||||:.:.|||||||||||||||||:||.|:..||||||||:|||||||||||:||:||.||||
Human   579 LGNACWVHKHFTEDIQTRQYRSIEVLIGAGYSTPADIWSTACMAFELATGDYLFEPHSGEDYSRD 643

  Fly   922 EDHLAHIVELLGSIPQ-------------------SVIFR------------GKHGLKYFTSYGS 955
            |||:|||:|||||||:                   ::|..            ||:..::||..|.
Human   644 EDHIAHIIELLGSIPRHFALSGKYSREFFNRRDHIALIIELLGKVPRKYAMLGKYSKEFFTRKGE 708

  Fly   956 LRNITKLKPWSLMNVLVEKYDWDPVEAKKFSDFLLPMLEYNPVIRASAAECLQHPWL 1012
            ||:|||||||||.:||||||.|...:|.:|:|||:||||..|..||||.|||:||||
Human   709 LRHITKLKPWSLFDVLVEKYGWPHEDAAQFTDFLIPMLEMVPEKRASAGECLRHPWL 765

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Srpk79DNP_001246881.1 STKc_SRPK 336..>504 CDD:271038 98/168 (58%)
S_TKc 347..>492 CDD:214567 89/145 (61%)
STKc_SRPK <844..1012 CDD:271038 115/199 (58%)
SRPK2XP_024302662.1 STKc_SRPK2 116..>304 CDD:271119 103/190 (54%)
Na_Ca_ex <389..431 CDD:332332 10/51 (20%)
PKc_like <552..765 CDD:328722 120/239 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1290
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D290680at2759
OrthoFinder 1 1.000 FOG0000435
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127107
Panther 1 1.100 O PTHR24055
Phylome 1 0.910 0.615 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.