DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Srpk79D and SRPK1

Sequence 1:NP_001246881.1 Gene:Srpk79D FlyBaseID:FBgn0025702 Length:1018 Species:Drosophila melanogaster
Sequence 2:NP_003128.3 Gene:SRPK1 HGNCID:11305 Length:655 Species:Homo sapiens

Alignment Length:753 Identity:279/754 (37%)
Similarity:390/754 (52%) Gaps:158/754 (21%)


  Fly   293 SLSEPRGTLSTTDEIYPDSSDSSLYVSDEEQEDASQYCRGGYHPVVIGDIFDNRFRVVRKLGWGH 357
            |.::.||:...::...|:..:..|...|:||||.:.||:||||.|.|||:|:.|:.|:|||||||
Human    26 SETQHRGSAPHSESDLPEQEEEILGSDDDEQEDPNDYCKGGYHLVKIGDLFNGRYHVIRKLGWGH 90

  Fly   358 FSTVWLCRDLKDEKYVALKVVKSAPHYIETAADEIRLLEAIRDADPMDVKRERIVRLMNHFTVRG 422
            ||||||..|::.:|:||:||||||.||.|||.||||||:::|::||.|..||.:|:|::.|.:.|
Human    91 FSTVWLSWDIQGKKFVAMKVVKSAEHYTETALDEIRLLKSVRNSDPNDPNREMVVQLLDDFKISG 155

  Fly   423 VNGMHTCLVFEALGCSLYKLIVKNNYQGLAIAQVRNIIRQVLEGLDYLHSKCSIIHTDIKPENIL 487
            |||.|.|:|||.||..|.|.|:|:|||||.:..|:.||:|||:||||||:||.||||||||||||
Human   156 VNGTHICMVFEVLGHHLLKWIIKSNYQGLPLPCVKKIIQQVLQGLDYLHTKCRIIHTDIKPENIL 220

  Fly   488 LVIDNAAAMNQQIDDEINSLRVKGVDFPDSYISSIEKQTKSRAKWPLIEPNGSTNTNTNTSNSTA 552
            |      ::|:|                  ||..:..:.....:.....|:||       :.|||
Human   221 L------SVNEQ------------------YIRRLAAEATEWQRSGAPPPSGS-------AVSTA 254

  Fly   553 TNSNSSTPLAAVIMSTLDKEDTTTTTSSTLNSNTTSSLASKYSSLLGDSECNGGLGGSANINNRY 617
            .....:..::......|.|:           ....:.|..|....:.:.|...| .|....|.:.
Human   255 PQPKPADKMSKNKKKKLKKK-----------QKRQAELLEKRMQEIEEMEKESG-PGQKRPNKQE 307

  Fly   618 RTE------------KKITAKSSGDCDEDAESDTLGEQSTLASTMDSPTDLDPEPELDSKPNTVP 670
            .:|            .|:|.      ::..||.|:|:..||.             |.|::.....
Human   308 ESESPVERPLKENPPNKMTQ------EKLEESSTIGQDQTLM-------------ERDTEGGAAE 353

  Fly   671 EPSEGPIPE-QPTPNSTNSSCPSHNTATIAKSKINSNILSTCTSLTSTNEYCFTNTNTTTASTPS 734
            ....|.|.. ..|.||.|.:         .:.|.:.:..:.|.......|..|.::....:||..
Human   354 INCNGVIEVINYTQNSNNET---------LRHKEDLHNANDCDVQNLNQESSFLSSQNGDSSTSQ 409

  Fly   735 APPSATPSSAPALASATPPSTCTPSFTQIAPSATAPATSTTCTTSAEFYDGDHKTTSTSTTTTSN 799
            ...|                 |||..::::.:....::||...:.:|.:                
Human   410 ETDS-----------------CTPITSEVSDTMVCQSSSTVGQSFSEQH---------------- 441

  Fly   800 AISSATTTTATTTTAIAKLNVHANA-IPSQNQSQSSQNNTYTIQSLIDN---------------- 847
                           |::|.....| ||.:::.:...|..      :||                
Human   442 ---------------ISQLQESIRAEIPCEDEQEQEHNGP------LDNKGKSTAGNFLVNPLEP 485

  Fly   848 ---SNVRVKIADLGNACYDYHHFTEDIQTRQYRSIEVLLGAPYNYTADIWSTACLAFELATGDYL 909
               ..::||||||||||:.:.|||||||||||||:|||:|:.||..||||||||:||||||||||
Human   486 KNAEKLKVKIADLGNACWVHKHFTEDIQTRQYRSLEVLIGSGYNTPADIWSTACMAFELATGDYL 550

  Fly   910 FDPHAGESYSRDEDHLAHIVELLGSIPQSVIFRGKHGLKYFTSYGSLRNITKLKPWSLMNVLVEK 974
            |:||:||.|:|||||:|.|:||||.:|:.:|..||:..::||..|.|::|||||||.|..|||||
Human   551 FEPHSGEEYTRDEDHIALIIELLGKVPRKLIVAGKYSKEFFTKKGDLKHITKLKPWGLFEVLVEK 615

  Fly   975 YDWDPVEAKKFSDFLLPMLEYNPVIRASAAECLQHPWL 1012
            |:|...||..|:||||||||..|..||:|||||:||||
Human   616 YEWSQEEAAGFTDFLLPMLELIPEKRATAAECLRHPWL 653

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Srpk79DNP_001246881.1 STKc_SRPK 336..>504 CDD:271038 99/168 (59%)
S_TKc 347..>492 CDD:214567 91/145 (63%)
STKc_SRPK <844..1012 CDD:271038 111/187 (59%)
SRPK1NP_003128.3 PKc_like 69..>282 CDD:304357 110/255 (43%)
S_TKc 80..>224 CDD:214567 91/150 (61%)
STKc_SRPK1 <477..653 CDD:271118 109/176 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1290
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D290680at2759
OrthoFinder 1 1.000 FOG0000435
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127107
Panther 1 1.100 O PTHR24055
Phylome 1 0.910 0.630 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
87.790

Return to query results.
Submit another query.