DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Srpk79D and srpk3

Sequence 1:NP_001246881.1 Gene:Srpk79D FlyBaseID:FBgn0025702 Length:1018 Species:Drosophila melanogaster
Sequence 2:XP_694973.6 Gene:srpk3 ZFINID:ZDB-GENE-101025-2 Length:731 Species:Danio rerio

Alignment Length:834 Identity:299/835 (36%)
Similarity:400/835 (48%) Gaps:241/835 (29%)


  Fly   201 PLSLASMTAAL-PLAPLYGSPLSLPLTSSQSTTKLSYRDDFLQQIGYLPTTRIYSTPTSIVDEDK 264
            ||:|:.....| |.||:   |.|:|:|...|...:|..:                ||::.:....
Zfish   115 PLNLSQSPPDLQPPAPI---PHSIPITVVPSPVVVSSPE----------------TPSTPIAPSL 160

  Fly   265 AQQDFLSLSLSP----PLNRRRDMPALRGPFVSLSEPRGTLSTTDEIYPDSSDSSLYVSDEEQED 325
            .....|| |..|    |.|:.....||..|....|.|...|..:|              |||||:
Zfish   161 GLPSILS-STPPTPQAPSNQPTPPQALSPPPPDFSPPPAELLGSD--------------DEEQEN 210

  Fly   326 ASQYCRGGYHPVVIGDIFDNRFRVVRKLGWGHFSTVWLCRDLKDEKYVALKVVKSAPHYIETAAD 390
            .|.||:|||:||.|||:|:.|:.||||||||||||||||.||:.:::|||||||||.||.|||.|
Zfish   211 PSDYCKGGYYPVKIGDLFNGRYHVVRKLGWGHFSTVWLCWDLQRKRFVALKVVKSAQHYTETALD 275

  Fly   391 EIRLLEAIRDADPMDVKRERIVRLMNHFTVRGVNGMHTCLVFEALGCSLYKLIVKNNYQGLAIAQ 455
            ||:||:.:||:||.|.||||:|:|::.|.:.||||:|.|:|.|.||..|.|.|:|:||.||.:..
Zfish   276 EIKLLKCVRDSDPTDSKRERLVQLIDDFKISGVNGVHVCMVLEVLGHQLLKWIIKSNYMGLPLIC 340

  Fly   456 VRNIIRQVLEGLDYLHSKCSIIHTDIKPENILLVIDNAAAMNQQIDDEINSLRVKGVDFPDSYIS 520
            |::|:|||||||||||:||.|||||||||||||              |:|.:.|:.:        
Zfish   341 VKSILRQVLEGLDYLHTKCKIIHTDIKPENILL--------------EVNEVYVRRL-------- 383

  Fly   521 SIEKQTKSRAKWPLIEPNGSTNTNTNTSNSTATNSNSSTPLAAVIMSTLDKEDTTTTTSSTLNSN 585
            :.|.....:|..|  .|:||:                        :||..:|    .....::.|
Zfish   384 AAEATIWQKAGAP--PPSGSS------------------------VSTAPRE----KQMGKMSKN 418

  Fly   586 TTSSL---ASKYSSLLGD--------SECNGGLGGSANINNR--YRTEKKITAKSSGDCDEDAES 637
            ....|   |.:...||.:        .|.:|.|...|:.|.|  :|            ..||.|.
Zfish   419 KKKKLKRKAKRQQQLLDERLIDLQRMEELDGVLPSDASGNTRALWR------------LSEDEED 471

  Fly   638 DTLGEQSTLASTMDSPTDLDPEPELDSKPNTVPEPSEGPIPEQPTPNSTNS----SCPSHNTATI 698
            :....|:.                           ..|.:.:| :|.|.:|    ||..:.....
Zfish   472 NVKHAQTN---------------------------GNGALNKQ-SPESGSSWLEESCNGYGPLRF 508

  Fly   699 AKSKINSNILSTCTSLTSTNEYCFTNTNTTTASTPSAPPSATPSSAPALASATPPSTCTPSFTQI 763
                                               |:|.|.....:.::.|||..|         
Zfish   509 -----------------------------------SSPGSGLSGLSGSILSATSES--------- 529

  Fly   764 APSATAPATSTTCTTSAEFYDGDHKTTSTSTTTTSNAISSATTTTATTTTAIAKLNVHANAIPSQ 828
                   |.||....|.|           .:..:.|:.|:|              :...|.:.||
Zfish   530 -------ALSTLSGYSTE-----------RSLLSPNSYSAA--------------DFLVNPLESQ 562

  Fly   829 NQSQSSQNNTYTIQSLIDNSNVRVKIADLGNACYDYHHFTEDIQTRQYRSIEVLLGAPYNYTADI 893
            |..:                 :.:|||||||||:.:.||||||||||||::|||:||.|...|||
Zfish   563 NADK-----------------ISIKIADLGNACWVHKHFTEDIQTRQYRALEVLIGAEYGPPADI 610

  Fly   894 WSTACLAFELATGDYLFDPHAGESYSRDEDHLAHIVELLGSIPQSVIFRGKHGLKYFTSYGSLRN 958
            |||||:|||||||||||:||:||.|:|||||:|||:||||:||......|::..:||...|.||:
Zfish   611 WSTACMAFELATGDYLFEPHSGEDYTRDEDHIAHIIELLGAIPPHFALSGRYSREYFNRRGELRH 675

  Fly   959 ITKLKPWSLMNVLVEKYDWDPVEAKKFSDFLLPMLEYNPVIRASAAECLQHPWL 1012
            |..||||.|..||:|||:|...:|.:||||||.|||:.|..||:||:||||||:
Zfish   676 IANLKPWGLFEVLLEKYEWPLDQAAQFSDFLLTMLEFIPEKRATAAQCLQHPWI 729

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Srpk79DNP_001246881.1 STKc_SRPK 336..>504 CDD:271038 103/168 (61%)
S_TKc 347..>492 CDD:214567 95/145 (66%)
STKc_SRPK <844..1012 CDD:271038 104/168 (62%)
srpk3XP_694973.6 STKc_SRPK3 221..729 CDD:271120 260/693 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1290
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D290680at2759
OrthoFinder 1 1.000 FOG0000435
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127107
Panther 1 1.100 O PTHR24055
Phylome 1 0.910 0.643 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
76.780

Return to query results.
Submit another query.