DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Srpk79D and Srpk3

Sequence 1:NP_001246881.1 Gene:Srpk79D FlyBaseID:FBgn0025702 Length:1018 Species:Drosophila melanogaster
Sequence 2:XP_006528235.1 Gene:Srpk3 MGIID:1891338 Length:590 Species:Mus musculus

Alignment Length:720 Identity:272/721 (38%)
Similarity:360/721 (50%) Gaps:197/721 (27%)


  Fly   309 PDSSDSSLYVS--------------DEEQEDASQYCRGGYHPVVIGDIFDNRFRVVRKLGWGHFS 359
            |:||.|.|..:              ||||||...||:|||:||.|||:|:.|:.|||||||||||
Mouse    50 PESSGSELTPATPAPRLLQGLLGSDDEEQEDPKDYCKGGYYPVKIGDLFNGRYHVVRKLGWGHFS 114

  Fly   360 TVWLCRDLKDEKYVALKVVKSAPHYIETAADEIRLLEAIRDADPMDVKRERIVRLMNHFTVRGVN 424
            |||||.|::.:::|||||||||.||.|||.|||:||:.:||:||.|.|||.||:|::.|.:.|||
Mouse   115 TVWLCWDIQRKRFVALKVVKSAGHYTETAVDEIKLLKCVRDSDPSDPKRETIVQLIDDFRISGVN 179

  Fly   425 GMHTCLVFEALGCSLYKLIVKNNYQGLAIAQVRNIIRQVLEGLDYLHSKCSIIHTDIKPENILLV 489
            |:|.|:|.|.||..|.|.|:|:|||||.:..|::|:||||.||||||:||.|||||||||||||.
Mouse   180 GVHVCMVLEVLGHQLLKWIIKSNYQGLPVPCVKSIVRQVLHGLDYLHTKCKIIHTDIKPENILLC 244

  Fly   490 IDNAAAMNQQIDDEINSLRVKGVDFPDSYISSIEKQTKSRAKWPLIEPNGSTNTNTNTSNSTATN 554
            :.                        |:||..:..:.   .:|   :.:|:...:.:|.      
Mouse   245 VG------------------------DAYIRRLAAEA---TEW---QQSGAQPPSRSTV------ 273

  Fly   555 SNSSTPLAAVIMSTLDKEDTTTTTSSTLNSNTTSSLASKYSSLLGDSECNGGLGGSANINNRYRT 619
              |:.|...:.:..|.|           |.........|....|              :..|.|.
Mouse   274 --STAPQEVLQIGKLSK-----------NKRKKMRRKRKQQKRL--------------LEERLRD 311

  Fly   620 EKKITAKSSGDCDEDAESD-TLGEQSTLASTMDSPTDLDPEPELDSKPNTVPEPSEGPIPEQPTP 683
            .:::.|..:....||:.|. ..|..||      |.:...||       .|...||  |....|.|
Mouse   312 LQRLEAMEAAVQAEDSSSRLERGSGST------SSSGCHPE-------GTRAGPS--PASSSPVP 361

  Fly   684 NSTNSSCPSHNTATIAKSKINSNILSTCTSLT-STNEYCFTNTNTTTASTPSAPPSATPSSAPAL 747
            ....|..||..|:..:.|..::   ::|:.|: |:|:     ..|....:||.|..|:       
Mouse   362 GGERSLSPSSQTSGFSGSLFST---ASCSILSGSSNQ-----RETGGLLSPSTPFGAS------- 411

  Fly   748 ASATPPSTCTPSFTQIAPSATAPATSTTCTTSAEFYDGDHKTTSTSTTTTSNAISSATTTTATTT 812
                                                                             
Mouse   412 ----------------------------------------------------------------- 411

  Fly   813 TAIAKLNVHANAIPSQNQSQSSQNNTYTIQSLIDNSNVRVKIADLGNACYDYHHFTEDIQTRQYR 877
                  |:..|.:..||..:                 :::|||||||||:.:.||||||||||||
Mouse   412 ------NLLVNPLEPQNADK-----------------IKIKIADLGNACWVHKHFTEDIQTRQYR 453

  Fly   878 SIEVLLGAPYNYTADIWSTACLAFELATGDYLFDPHAGESYSRDEDHLAHIVELLGSIPQSVIFR 942
            ::|||:||.|...||||||||:|||||||||||:||:||.|||||||:||||||||.||.:....
Mouse   454 AVEVLIGAEYGPPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIAHIVELLGDIPPAFALS 518

  Fly   943 GKHGLKYFTSYGSLRNITKLKPWSLMNVLVEKYDWDPVEAKKFSDFLLPMLEYNPVIRASAAECL 1007
            |::..::|...|.||:|..||.|.|..||:|||:|...:|.:||.|||||:||.|..|||||:||
Mouse   519 GRYSREFFNRRGELRHIPNLKHWGLYEVLMEKYEWPLEQATQFSAFLLPMMEYIPEKRASAADCL 583

  Fly  1008 QHPWL 1012
            |||||
Mouse   584 QHPWL 588

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Srpk79DNP_001246881.1 STKc_SRPK 336..>504 CDD:271038 101/168 (60%)
S_TKc 347..>492 CDD:214567 94/145 (65%)
STKc_SRPK <844..1012 CDD:271038 105/168 (63%)
Srpk3XP_006528235.1 STKc_SRPK3 91..588 CDD:271120 255/678 (38%)
S_TKc 102..588 CDD:214567 248/667 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1290
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S2039
OMA 1 1.010
OrthoDB 1 1.010 D290680at2759
OrthoFinder 1 1.000 FOG0000435
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127107
Panther 1 1.100 O PTHR24055
Phylome 1 0.910 0.615 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
98.740

Return to query results.
Submit another query.