DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Srpk79D and srpk1

Sequence 1:NP_001246881.1 Gene:Srpk79D FlyBaseID:FBgn0025702 Length:1018 Species:Drosophila melanogaster
Sequence 2:XP_017946778.1 Gene:srpk1 XenbaseID:XB-GENE-941978 Length:648 Species:Xenopus tropicalis

Alignment Length:788 Identity:275/789 (35%)
Similarity:387/789 (49%) Gaps:207/789 (26%)


  Fly   280 RRRDMPALRGPFVSLSEPRGTLSTTDEIYPDSSDSSLYVS-DEEQEDASQYCRGGYHPVVIGDIF 343
            |::...|.:.|....:....::..|:.:.|:..:..:..| |:||||.:.||:||||.|.|||:|
 Frog    11 RKKRTKAKKVPKKQEATQHASVRETEGVLPEEDEEEILGSDDDEQEDPNDYCKGGYHHVKIGDLF 75

  Fly   344 DNRFRVVRKLGWGHFSTVWLCRDLKDEKYVALKVVKSAPHYIETAADEIRLLEAIRDADPMDVKR 408
            ..|:.|:|||||||||||||.|||:.:::||:||||||.||.|||.|||:||.::|:.||.|..|
 Frog    76 CGRYHVIRKLGWGHFSTVWLSRDLQAKRFVAMKVVKSAEHYTETALDEIKLLRSVRNTDPTDPNR 140

  Fly   409 ERIVRLMNHFTVRGVNGMHTCLVFEALGCSLYKLIVKNNYQGLAIAQVRNIIRQVLEGLDYLHSK 473
            ||:|:|::.|.:.|.||.|.|:|||.||..|.|.|:|:||||:.:..|::||||||:||||||||
 Frog   141 ERVVQLLDDFKISGANGTHVCMVFEVLGHHLLKWIIKSNYQGVPLPCVKSIIRQVLQGLDYLHSK 205

  Fly   474 CSIIHTDIKPENILLVIDNAAAMNQQIDDEINSLRVKGVDFPDSYISSIEKQTKSRAKWPLIEPN 538
            |.|||||||||||||.:.                        :::|..:..:.....:.....|:
 Frog   206 CQIIHTDIKPENILLSVS------------------------ETFIRRLAAEATEWQRSGAPPPS 246

  Fly   539 GS-TNTNTNTSNSTATNSNSSTPL-------AAVI------MSTLDKEDTTTTTSSTLNSNTTSS 589
            || .:|......||..:.|....|       |.::      :..:|:||......||..:..|.:
 Frog   247 GSAVSTAPPPKQSTKMSKNKKRKLKKKQKRQAELLEKRVQEIEEMDREDENQDEDSTEQAQETWT 311

  Fly   590 LASKYSSLLG-DSECNGGLGGSANINNRYRTEKKITAKSSGDCDEDAESDTLGEQSTLASTMDSP 653
            ....:|...| :..|||......:.||     :::...::..|       |:...|:|.|..:.|
 Frog   312 DPDTHSYSRGSELNCNGLTSEIPSENN-----ERLPQNNTYSC-------TVTSSSSLDSPCEQP 364

  Fly   654 TDLDPEPE-LDSKPNTVPEPSEGPIPEQPTPNSTNSSCPSHNTATIAK-SKINSNILSTCTSLTS 716
            .: ||.|. ||::.|.:|...|..:       |..|:..||......: ||:..:|         
 Frog   365 RE-DPNPLCLDTEENNLPNAGEVIL-------SQTSAVQSHKHIENEEISKLQESI--------- 412

  Fly   717 TNEYCFTNTNTTTASTPSAPPSATPSSAPALASATPPSTCTPSFTQIAPSATAPATSTTCTTSAE 781
            ..|.|                |.....:||:                                  
 Frog   413 RKEMC----------------SEEQEGSPAM---------------------------------- 427

  Fly   782 FYDGDHKTTSTSTTTTSNAISSATTTTATTTTAIAKLNVHANAIPSQNQSQSSQNNTYTIQSLID 846
                              .||:.|              :..|.:..||.                
 Frog   428 ------------------KISANT--------------LLLNPLEPQNA---------------- 444

  Fly   847 NSNVRVKIADLGNACYDYHHFTEDIQTRQYRSIEVLLGAPYNYTADIWSTACLAFELATGDYLFD 911
             .:::||||||||||:...|||||||||||||:|||:|:.|:..||||||||:|||||||||||:
 Frog   445 -EHLKVKIADLGNACWVQKHFTEDIQTRQYRSLEVLIGSGYSTPADIWSTACMAFELATGDYLFE 508

  Fly   912 PHAGESYSRDE-------------------------------------DHLAHIVELLGSIPQSV 939
            ||:||:|||||                                     ||:|.|:||||.||:.:
 Frog   509 PHSGENYSRDEDHTAQIIDSRQGSHVTLRSFANTQRGSVSTVISHLKTDHIALIIELLGRIPRKL 573

  Fly   940 IFRGKHGLKYFTSYGSLRNITKLKPWSLMNVLVEKYDWDPVEAKKFSDFLLPMLEYNPVIRASAA 1004
            |..||:..::||..|.|::|:|||||.|.:||||||:|...:|..|:||::||||..|..||:|:
 Frog   574 IVAGKYSKEFFTKKGDLKHISKLKPWGLYDVLVEKYEWAEEDAAGFTDFVMPMLELAPEKRATAS 638

  Fly  1005 ECLQHPWL 1012
            :||.||||
 Frog   639 QCLNHPWL 646

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Srpk79DNP_001246881.1 STKc_SRPK 336..>504 CDD:271038 98/168 (58%)
S_TKc 347..>492 CDD:214567 92/145 (63%)
STKc_SRPK <844..1012 CDD:271038 104/205 (51%)
srpk1XP_017946778.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1290
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D290680at2759
OrthoFinder 1 1.000 FOG0000435
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.880

Return to query results.
Submit another query.