DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Srpk79D and bsk

Sequence 1:NP_001246881.1 Gene:Srpk79D FlyBaseID:FBgn0025702 Length:1018 Species:Drosophila melanogaster
Sequence 2:NP_001162930.1 Gene:bsk FlyBaseID:FBgn0000229 Length:372 Species:Drosophila melanogaster

Alignment Length:226 Identity:56/227 (25%)
Similarity:82/227 (36%) Gaps:72/227 (32%)


  Fly   820 VHANAIPSQNQSQSSQNNTYTIQSLIDNSNVRVKIADLGNACYDYHHF--TEDIQTRQYRSIEVL 882
            :|.:..||               :::..::..:||.|.|.|......|  |..:.||.||:.||:
  Fly   146 IHRDLKPS---------------NIVVKADCTLKILDFGLARTAGTTFMMTPYVVTRYYRAPEVI 195

  Fly   883 LGAPYNYTADIWSTACLAFELATGDYLFDPHAGESYSRDEDHLAH---IVELLGSIPQSVIFRGK 944
            ||..|....||||..|:..|:..|..||.         ..||:..   |:|.||:...|.:.|  
  Fly   196 LGMGYTENVDIWSVGCIMGEMIRGGVLFP---------GTDHIDQWNKIIEQLGTPSPSFMQR-- 249

  Fly   945 HGLKYFTSYGSLRNITKLKPWSLMNVLVEKYDWDPVEAKKFSDFLLP------------------ 991
                   ...::||..:.:|      ....|.:|    :.|.|.|.|                  
  Fly   250 -------LQPTVRNYVENRP------RYTGYSFD----RLFPDGLFPNDNNQNSRRKASDARNLL 297

  Fly   992 --MLEYNPVIRASAAECLQHP----WLEQEE 1016
              ||..:|..|.|..|.|:|.    |.:.||
  Fly   298 SKMLVIDPEQRISVDEALKHEYINVWYDAEE 328

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Srpk79DNP_001246881.1 STKc_SRPK 336..>504 CDD:271038
S_TKc 347..>492 CDD:214567
STKc_SRPK <844..1012 CDD:271038 51/197 (26%)
bskNP_001162930.1 STKc_JNK 23..359 CDD:270840 56/227 (25%)
S_TKc 24..320 CDD:214567 53/217 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24055
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.