DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Srpk79D and SRPK

Sequence 1:NP_001246881.1 Gene:Srpk79D FlyBaseID:FBgn0025702 Length:1018 Species:Drosophila melanogaster
Sequence 2:NP_001260993.1 Gene:SRPK FlyBaseID:FBgn0286813 Length:939 Species:Drosophila melanogaster

Alignment Length:738 Identity:279/739 (38%)
Similarity:390/739 (53%) Gaps:117/739 (16%)


  Fly   297 PRGTLSTTDEIYPDSSDSSLYVSDEEQEDASQYCRGGYHPVVIGDIFDNRFRVVRKLGWGHFSTV 361
            ||   |:::|.|    :|..:..:|:||....||:||||||.|||:|.:|:.|:|||||||||||
  Fly   127 PR---SSSNESY----ESETFSDNEDQELMEDYCKGGYHPVNIGDLFHDRYHVIRKLGWGHFSTV 184

  Fly   362 WLCRDLKDEKYVALKVVKSAPHYIETAADEIRLLEAIRDADPMDVKRERIVRLMNHFTVRGVNGM 426
            |||.||:...|||:|:||||||:.|||.|||::|:.:|:.||.:.:|.:.|::::.|.:.||||.
  Fly   185 WLCWDLQAMGYVAIKIVKSAPHFAETARDEIKILKTVRETDPSNPRRHKTVQMLDDFKITGVNGT 249

  Fly   427 HTCLVFEALGCSLYKLIVKNNYQGLAIAQVRNIIRQVLEGLDYLHSKCSIIHTDIKPENILLVID 491
            |.|:|||.||.:|.|||.|:||:|:.:|.|:.|.|||||||||||:.|.||||||||||:||.:|
  Fly   250 HICMVFEVLGDNLLKLIRKSNYRGIPLANVKTITRQVLEGLDYLHTCCKIIHTDIKPENVLLCVD 314

  Fly   492 NAAAMNQQIDDEINSLRVKGVDFPDSYI--SSIEKQTKSRAKWPLIEPNGSTNTNTNTSNSTATN 554
                     :..:.||..:....   |.  |.:.....|||.....||..:...:.|........
  Fly   315 ---------EPHVRSLATEATQL---YCMNSKMYPSLVSRAPKEYREPPITGKMSKNRKKKLKKK 367

  Fly   555 SNSSTPLAAVIMSTLDKEDTTTTTSSTLNSNTTSSLASKYSSLLGDSECNGGLGGSANINNRYRT 619
            :.....|.......|::.|    ....:|.|...:                   |.|.|:     
  Fly   368 AKKRMELFKQQRDYLEQAD----GQGAINPNEVQN-------------------GDAGIS----- 404

  Fly   620 EKKITAKSSGDCDEDAESDTLGEQSTLASTMDSPTDLDPEPELDSKPNTVPEPSEGPIPEQPTPN 684
                      |.||..:::::.:...:|:.       .|..:...:....||.||....:.|...
  Fly   405 ----------DADEYFDANSVEDNVHVAAG-------QPSRKQREERKAPPEQSEEAQEQDPLTE 452

  Fly   685 STNSSCPSHNTATIAKSKINSNILSTCTSLTSTNEYCFTNTNTTTASTPSAPP-------SATPS 742
            .|:.          ||.|....                 |.|.:..|....||       ||..|
  Fly   453 GTDK----------AKKKKKKK-----------------NKNKSNQSKGQQPPQLENSTSSAESS 490

  Fly   743 SAPALASATPPSTCTPSFTQIAPSATAPATST----TCTTSAEFYDGDHKTTSTSTTTTSNAISS 803
            ||.....|...::.|.:.:....|.|....|.    ......|....:|:..:.::...||:.|.
  Fly   491 SALKSQQANGSNSTTNNKSNTNSSGTLKGQSNGKKMPLRPKQEKQGSNHQLNNNNSKPNSNSDSK 555

  Fly   804 ATTTTATTTTAIAKLNVHANAI------PSQNQSQSSQNNTYTIQSLIDNSNVRVKIADLGNACY 862
            .::.:...|:: |....|:|:.      |.|.:.::.::      ..:|..||.||||||||||:
  Fly   556 ISSGSVENTSS-ATNGPHSNSTLPTPPPPPQAKHKAKKD------PALDECNVHVKIADLGNACW 613

  Fly   863 DYHHFTEDIQTRQYRSIEVLLGAPYNYTADIWSTACLAFELATGDYLFDPHAGESYSRDEDHLAH 927
            ...|||||||||||||:||::||.||.:||||||||:.||||||||||:||:||||:||||||||
  Fly   614 VDRHFTEDIQTRQYRSLEVIIGAGYNTSADIWSTACMVFELATGDYLFEPHSGESYTRDEDHLAH 678

  Fly   928 IVELLGSIPQSVIFRGKHGLKYFTSYGSLRNITKLKPWSLMNVLVEKYDWDPVEAKKFSDFLLPM 992
            |:||||.||:.::..|.:..|.||....||||:.||||.||:||:|||:|...:|..|:.||.||
  Fly   679 IIELLGPIPREILLNGTYAAKSFTRSCELRNISGLKPWGLMDVLLEKYEWSQKDAASFASFLTPM 743

  Fly   993 LEYNPVIRASAAECLQHPWLEQE 1015
            ||::|..||:||||||||||. :
  Fly   744 LEFDPNKRATAAECLQHPWLRXD 766

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Srpk79DNP_001246881.1 STKc_SRPK 336..>504 CDD:271038 94/168 (56%)
S_TKc 347..>492 CDD:214567 87/145 (60%)
STKc_SRPK <844..1012 CDD:271038 111/168 (66%)
SRPKNP_001260993.1 STKc_SRPK 159..>318 CDD:271038 94/168 (56%)
STKc_SRPK <600..763 CDD:271038 110/163 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1290
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 389 1.000 Inparanoid score I489
Isobase 1 0.950 0 Normalized mean entropy S2039
OrthoDB 1 1.010 D290680at2759
OrthoFinder 1 1.000 FOG0000435
orthoMCL 1 0.900 OOG5_127107
Panther 1 1.100 P PTHR24055
RoundUp 00.000 Not matched by this tool.
76.910

Return to query results.
Submit another query.