DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Srpk79D and Srpk1

Sequence 1:NP_001246881.1 Gene:Srpk79D FlyBaseID:FBgn0025702 Length:1018 Species:Drosophila melanogaster
Sequence 2:XP_017457167.1 Gene:Srpk1 RGDID:1308272 Length:686 Species:Rattus norvegicus

Alignment Length:778 Identity:279/779 (36%)
Similarity:383/779 (49%) Gaps:181/779 (23%)


  Fly   295 SEPRGTLSTTDEIYPDSSDSSLYVSDEEQEDASQYCRGGYHPVVIGDIFDNRFRVVRKLGWGHFS 359
            ::.||:...::...|:..:..|...|:||||.:.||:||||.|.|||:|:.|:.|:|||||||||
  Rat    28 TQHRGSAPHSESDIPEQEEEILGSDDDEQEDPNDYCKGGYHLVKIGDLFNGRYHVIRKLGWGHFS 92

  Fly   360 TVWLCRDLKDEKYVALKVVKSAPHYIETAADEIRLLEAIRDADPMDVKRERIVRLMNHFTVRGVN 424
            ||||..|::.:|:||:||||||.||.|||.||||||:::|::||.|...|.:|:|::.|.:.|||
  Rat    93 TVWLSWDIQGKKFVAMKVVKSAEHYTETALDEIRLLKSVRNSDPNDPNGEMVVQLLDDFKISGVN 157

  Fly   425 GMHTCLVFEALGCSLYKLIVKNNYQGLAIAQVRNIIRQVLEGLDYLHSKCSIIHTDIKPENILLV 489
            |.|.|:|||.||..|.|.|:|:|||||.:..|:.||:|||:||||||:||.||||||||||||| 
  Rat   158 GTHICMVFEVLGHHLLKWIIKSNYQGLPLPCVKKIIQQVLQGLDYLHTKCRIIHTDIKPENILL- 221

  Fly   490 IDNAAAMNQQIDDEINSLRVKGVDFPDSYISSIEKQTKSRAKWPLIEPNGSTNTNTNTSNSTATN 554
                 ::|:|                  ||..:..:.....:.....|:||       :.|||..
  Rat   222 -----SVNEQ------------------YIRRLAAEATEWQRSGAPPPSGS-------AVSTAPQ 256

  Fly   555 SNSSTPLAAVIMSTLDKEDTTTTTSSTLNSNTTSSLASKYSSLLGDSECNGGLGGSANINNRYRT 619
            ...:..::......|.|:           ....:.|..|....:.:.|...| .|....|.:..:
  Rat   257 PKPADKMSKNKKKKLKKK-----------QKRQAELLEKRMQEIEEMEKESG-PGQKRPNKQEES 309

  Fly   620 ----EKKITAKSSGDCDED--AESDTLGEQSTLASTMDSPTDLDPEPELDSKPNTVPEPSEGPIP 678
                |:.:|........::  .||.::|:..||..                      ...||..|
  Rat   310 ESPVERPLTENPPNKMTQEKLEESSSIGQDQTLTE----------------------HGGEGGAP 352

  Fly   679 E----------QPTPNSTNSSCPSHNTATIAKSKINSNILSTCTSLTSTNEYCFTNTNTTTASTP 733
            |          ..|.||.|      .|..:.:...|:|   .|...|...|..|       .|:|
  Rat   353 EINCNGVIGIVNYTANSNN------ETLRLKEDLHNAN---DCDGRTLKQEPSF-------LSSP 401

  Fly   734 SAPPSATPSSAPALASATPPSTCTPSFTQIAPSATAPATSTTCTTSAEFYDGDHKTTSTSTTTTS 798
            :...|.:|.:          .:||||.:::      |.| ..|..|.|                 
  Rat   402 NGDSSPSPET----------DSCTPSGSEV------PET-MACQASVE----------------- 432

  Fly   799 NAISSATTTTATTTTAIAKLNVHANAIPSQNQSQSSQNNTYTIQSLIDNSN-------------V 850
               .|.|.|....|....::..|.   ||.::.:...|.....:......|             :
  Rat   433 ---RSLTLTQQDITHLQERIRAHT---PSGDEQEREHNGALDSKGKFSAGNFLLNPLEPKNAEKL 491

  Fly   851 RVK------------------------------IADLGNACYDYH-HFTEDIQTRQYRSIEVLLG 884
            :||                              :..||:..|..| |||||||||||||:|||:|
  Rat   492 KVKMLIWECLAGVVSHTFWCCTPEVTGEGQSGSVTLLGSWMYAQHKHFTEDIQTRQYRSLEVLIG 556

  Fly   885 APYNYTADIWSTACLAFELATGDYLFDPHAGESYSRDEDHLAHIVELLGSIPQSVIFRGKHGLKY 949
            :.||..||||||||:|||||||||||:||:||.|:|||||:|.|:||||.:|:.:|..||:..::
  Rat   557 SGYNTPADIWSTACMAFELATGDYLFEPHSGEDYTRDEDHIALIIELLGKVPRKLIVAGKYSKEF 621

  Fly   950 FTSYGSLRNITKLKPWSLMNVLVEKYDWDPVEAKKFSDFLLPMLEYNPVIRASAAECLQHPWL 1012
            ||..|.|::|||||||.|:.||||||:|...||..|:||||||||..|..||:|||||:||||
  Rat   622 FTKKGDLKHITKLKPWGLLEVLVEKYEWPQEEAAGFTDFLLPMLELMPEKRATAAECLRHPWL 684

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Srpk79DNP_001246881.1 STKc_SRPK 336..>504 CDD:271038 98/168 (58%)
S_TKc 347..>492 CDD:214567 90/145 (62%)
STKc_SRPK <844..1012 CDD:271038 106/212 (50%)
Srpk1XP_017457167.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1290
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D290680at2759
OrthoFinder 1 1.000 FOG0000435
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127107
Panther 1 1.100 O PTHR24055
Phylome 1 0.910 0.615 Consistency score
TreeFam 1 0.960
76.780

Return to query results.
Submit another query.