DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Srpk79D and madd-3

Sequence 1:NP_001246881.1 Gene:Srpk79D FlyBaseID:FBgn0025702 Length:1018 Species:Drosophila melanogaster
Sequence 2:NP_001355454.1 Gene:madd-3 WormBaseID:WBGene00006517 Length:890 Species:Caenorhabditis elegans

Alignment Length:1177 Identity:198/1178 (17%)
Similarity:308/1178 (26%) Gaps:603/1178 (51%)


  Fly    15 PHLIS----------PTHTSLPAGICSSDSGIST-------------LSAISPPLST------ST 50
            ||.:|          ||.:.:|     |.:.||.             |||..||..|      ::
 Worm   118 PHAVSEKPGDKKSTGPTPSPVP-----SKAPISAAKLPGTVTKVAPLLSAAQPPPKTLAPAPGAS 177

  Fly    51 TTASGAG-------------GGVGGSPQLRTSPALSMLGSATAT----ASGV----------TAS 88
            .|.||:|             ....|:...:|..|:..:.|:.:|    ||.|          ||:
 Worm   178 ETNSGSGPVSKQVSGKLTELKSKNGTVTEKTEKAVLRIPSSASTRAKAASAVAPEANPAPVPTAT 242

  Fly    89 SGCGLTAGI--------LGPAASIDLGS---SPLSHRN----------------------YSNSL 120
            ........|        ..|.|.|...:   .|::.:|                      ..|.:
 Worm   243 KPSPFAPAIAPLRDGAPAQPPAPIQASAPLRPPVAKQNSLQKPPEPKRSVGAPPKALPSELVNKI 307

  Fly   121 KGFSF-----RRSFDDKIINTPYLSRAPAYTHGIPYPHFHGTQPAATTPHHLHLHHHGNGTAAGS 180
            .|..|     .::.||                        |.||..:|.....|..     |.||
 Worm   308 DGIEFLPQSSNQNTDD------------------------GQQPTTSTGGAKALRR-----AYGS 343

  Fly   181 GSG-----VG-------SGPGSGSGAGGLYQQPLSLASMTAALPLAPLYGSPLS-------LPLT 226
            .||     :|       |.|..|.....|.::.|||.....:....|..||.|:       :.|:
 Worm   344 KSGTTICAIGSPNVPSTSQPQQGDNEKRLIEKKLSLRKKKLSGEGVPPAGSMLTGSKSGVEIGLS 408

  Fly   227 SSQSTTKLSYRDD-----------------FLQQIGYLPTTRI---YSTPTSIVDEDKAQQDFLS 271
            |:.:||..:...:                 |..|.|....|.:   .||.||  .|:.|.|    
 Worm   409 SNLTTTNNNNNKEQTDEQRAKKTVNAVAAAFSTQAGSGNATTVDDPASTTTS--KENPAAQ---- 467

  Fly   272 LSLSPPLNRRRDMPALRGPFVSLSEPRGTLSTTDEIYP------DSSDSSLYVSD---------E 321
                ||   :....|::.....|..|....:..|:|..      ..|.|.|..|.         .
 Worm   468 ----PP---KPKSAAVQNLISQLQLPASVSAKVDKIIACGDKARKPSRSGLQASQARPKVPEIVS 525

  Fly   322 EQEDASQYCRGGYHPVVIGDIFDNRFRVVRKLGWGHFSTVWLCRDLKDEKYVALKVVKSAPHYIE 386
            .|....|..:.|:.....||...|||.:...||.|.|..|....|...:.::|||::|:...|.|
 Worm   526 SQRTQHQDDKDGHLIYSKGDFILNRFTIYDTLGEGTFGKVVRVNDSLSDTFMALKIIKNVSKYRE 590

  Fly   387 TAADEIRLLEAIRDADPMDVKRERIVRLMNHFTVRGVNGMHTCLVFEALGCSLYKLIVKNNYQGL 451
            .|..|:::|:.:.:.||  .|:..::.:.::|...|    |.||:|:.:|.|::..:..|:|:..
 Worm   591 AAKLEVKVLQKLAEKDP--EKKNWVIHMGSYFDYNG----HICLLFDLMGSSIFDFLKANHYKPY 649

  Fly   452 AIAQVRNIIRQVLEGLDYLHSKCSIIHTDIKPENILLVIDNAAAMNQQIDDEINSLRVKGVDFPD 516
            .:.|..:|..|:...:.:||.. .:.|||:||||||.|                           
 Worm   650 PMEQTLHITWQLCNAVKFLHDN-KLTHTDLKPENILFV--------------------------- 686

  Fly   517 SYISSIEKQTKSRAKWPLIEPNGSTNTNTNTSNSTATNSNSSTPLAAVIMSTLDKEDTTTTTSST 581
                                                                             
 Worm   687 ----------------------------------------------------------------- 686

  Fly   582 LNSNTTSSLASKYSSLLGDSECNGGLGGSANINNRYRTEKKITAKSSGDCDEDAESDTLGEQSTL 646
                                            ::||.|:.                         
 Worm   687 --------------------------------DSRYTTKL------------------------- 694

  Fly   647 ASTMDSPTDLDPEPELDSKPNTVPEPSEGPIPEQPTPNSTNSSCPSHNTATIAKSKINSNILSTC 711
                           :|.||..|                      .|:|                
 Worm   695 ---------------VDKKPLRV----------------------LHST---------------- 706

  Fly   712 TSLTSTNEYCFTNTNTTTASTPSAPPSATPSSAPALASATPPSTCTPSFTQIAPSATAPATSTTC 776
                                                                             
 Worm   707 ----------------------------------------------------------------- 706

  Fly   777 TTSAEFYDGDHKTTSTSTTTTSNAISSATTTTATTTTAIAKLNVHANAIPSQNQSQSSQNNTYTI 841
                                                                             
 Worm   707 ----------------------------------------------------------------- 706

  Fly   842 QSLIDNSNVRVKIADLGNACYDYHHFTEDIQTRQYRSIEVLLGAPYNYTADIWSTACLAFELATG 906
                     .|::.|.|:|.:|:.|.:..:.||.||:.||:|...::...|:||..|:.:||.||
 Worm   707 ---------HVRLIDFGSATFDHEHHSIIVSTRHYRAPEVILELGWSQPCDVWSIGCILYELYTG 762

  Fly   907 DYLFDPHAGESYSRDEDHLAHIVELLGSIP-----QSVIFRGKHGLKYFTSYGSLRNITKLKPWS 966
            ..||..|      .:.:|||.:..:||.||     ::..||    .|:|.: |.|          
 Worm   763 VTLFQTH------ENREHLAMMERVLGDIPLRMAKRTNTFR----TKFFIN-GRL---------- 806

  Fly   967 LMNVLVEKYDW------------------------DPVEAKKFSDFLLPMLEYNPVIRASAAECL 1007
                     ||                        ||...:.| :.:..||.:.|:.|....|.|
 Worm   807 ---------DWVNTSADAAYVRDNCKPLRRSMSCTDPEHVELF-ELIENMLMFEPLARMKLPEAL 861

  Fly  1008 QHPWLEQ 1014
            ||.:..:
 Worm   862 QHRYFNR 868

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Srpk79DNP_001246881.1 STKc_SRPK 336..>504 CDD:271038 48/168 (29%)
S_TKc 347..>492 CDD:214567 44/145 (30%)
STKc_SRPK <844..1012 CDD:271038 50/197 (25%)
madd-3NP_001355454.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D290680at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.