DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Srpk79D and p38b

Sequence 1:NP_001246881.1 Gene:Srpk79D FlyBaseID:FBgn0025702 Length:1018 Species:Drosophila melanogaster
Sequence 2:NP_477361.1 Gene:p38b FlyBaseID:FBgn0024846 Length:365 Species:Drosophila melanogaster

Alignment Length:178 Identity:53/179 (30%)
Similarity:76/179 (42%) Gaps:36/179 (20%)


  Fly   847 NSNVRVKIADLGNACYDYHHFTEDIQTRQYRSIEVLLG-APYNYTADIWSTACLAFELATGDYLF 910
            |.:..::|.|.|.|.......|..:.||.||:.|::|. ..||.||||||..|:..||.||..||
  Fly   162 NEDCELRILDFGLARPAESEMTGYVATRWYRAPEIMLNWMHYNQTADIWSVGCIMAELLTGRTLF 226

  Fly   911 DPHAGESYSRDEDHLAH---IVELLGSIPQSVIFRGKHGLKYFTSYGSLRNITKLKPWSLMNVLV 972
            .         ..||:..   |:|:||:.....:.|        .|..|.||..:..|     |:.
  Fly   227 P---------GTDHIHQLNLIMEVLGTPADEFMSR--------ISSESARNYIRSLP-----VMP 269

  Fly   973 EKYDWD------PVEAKKFSDFLLPMLEYNPVIRASAAECLQHPWLEQ 1014
            .:...|      |:..    |.|..|||.:...|.:|.:.|.||::|:
  Fly   270 RRNFRDIFRGANPLAI----DLLEKMLELDADKRITAEQALAHPYMEK 313

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Srpk79DNP_001246881.1 STKc_SRPK 336..>504 CDD:271038
S_TKc 347..>492 CDD:214567
STKc_SRPK <844..1012 CDD:271038 52/175 (30%)
p38bNP_477361.1 STKc_p38 8..353 CDD:143356 53/179 (30%)
S_TKc 24..311 CDD:214567 52/175 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24055
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.