DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Srpk79D and CG42366

Sequence 1:NP_001246881.1 Gene:Srpk79D FlyBaseID:FBgn0025702 Length:1018 Species:Drosophila melanogaster
Sequence 2:NP_723501.2 Gene:CG42366 FlyBaseID:FBgn0259712 Length:706 Species:Drosophila melanogaster

Alignment Length:749 Identity:145/750 (19%)
Similarity:252/750 (34%) Gaps:227/750 (30%)


  Fly   345 NRFRVVRKLGWGHFSTVWLCRDLKDEKYVALKVVKSAPHYIETAAD--EIRLLEAIRDADPMDVK 407
            ||:..:.:||.|.:.||.|.:.....:.||:|.:|...:..|.|.:  |::.|:.:  :.|..||
  Fly     2 NRYITLTQLGDGTYGTVVLGQRKDTGEKVAIKRMKRKYYSWEEAMNLREVKSLKKL--SHPNIVK 64

  Fly   408 RERIVRLMNHFTVRGVNGMHTCLVFEALGCSLYKLIVKNNYQGLAIAQVRNIIRQVLEGLDYLHS 472
            .:.::|  .:.|:        ..|||.:..:||::| |:....|...::::|:.|||.||.::| 
  Fly    65 LKEVIR--ENDTL--------YFVFEYMKENLYQMI-KDRDTHLPEPELKSILFQVLTGLAFMH- 117

  Fly   473 KCSIIHTDIKPENILL------------------------------------VIDNAAAMNQQID 501
            :....|.|:||||:|.                                    |:.::......||
  Fly   118 RHGFFHRDLKPENLLCSGPDLIKIADFGLAREIRSRPPFTDYVSTRWYRAPEVLLHSTNYGSTID 182

  Fly   502 ---------------------DEINSL----RVKGV----DFPDSY-----------------IS 520
                                 .|::.|    .|.|.    |:||.|                 :|
  Fly   183 LWAMGCIMAELYTFRPLFPGSSEVDQLFKICSVLGTPDKDDWPDGYRLASMIHFRYPDCIKVPLS 247

  Fly   521 SI---------------------EKQTKSRA-KWPL------IEPNGSTNTNTN-TSNSTATNSN 556
            |:                     ::.|..:: |:|.      |.|..:|..|.. .|...|:|.:
  Fly   248 SVVSRCSQNGLDLLEDMLAYDPDKRPTAQQSLKYPYFHALKRISPTAATKANVRLNSKYAASNGH 312

  Fly   557 SSTPLAAVIMSTLDKEDTTT----TTSSTLNSNT----TSSLASKYSSLLGDSECNGGLGGSANI 613
            ....::..::...:|....|    .|::.:||::    .::||.|          |||      :
  Fly   313 PVQSVSNNVLPVQEKLQAVTELLHQTNNNMNSHSNLGKNNNLAPK----------NGG------V 361

  Fly   614 NNRYRTEKKITAKSSGDCDEDAESDTLGEQSTLASTMDSPTDLDPEPELDSKPNTVPE------- 671
            ..:|:.:......|.......|:|.:|...:|:        |..|.|:..:...::.:       
  Fly   362 PRKYQPKLSFLTTSEMGAGSHADSSSLVGGATV--------DGVPVPQHQNGGESINDIYLNRNI 418

  Fly   672 ------PSEGPIPEQPT----PNSTNSSCPSHNTATIAKSKINSNILS--TCTSLTSTNEYCFTN 724
                  |: ||..:|..    ||.:.|:..|.|...|   .:|.:.||  |.......|......
  Fly   419 SQLFGLPA-GPQHQQQQQVHHPNVSFSTTSSRNAGAI---YVNGSHLSYDTANMNAKNNAKFVVG 479

  Fly   725 TNTTTASTPSAPPSATPSSAPAL-------ASATPPSTCTPSFTQIAPS-ATAPATSTTCTTSAE 781
            .:......|.|.||.....|...       ||..|||..... .|:.|. |.||...:..:.:|.
  Fly   480 ASNGGYYVPVARPSLLGPDAKVYNVFSKVSASQAPPSLIVRQ-PQLQPEVAPAPMRLSGRSRAAA 543

  Fly   782 FYDGDHKTTSTSTTTTSNAISSATTTTATTTTAIAKLNV------------------HANAIPSQ 828
            ... |.|..:..:......:.|...|:|..... ||.|:                  :.:.:|..
  Fly   544 AVQ-DPKMGALKSDDLDLILGSKLKTSAKRQRN-AKANILLEDLFGQLSMDSDSDGKYPHTVPPT 606

  Fly   829 NQSQSSQNNT-----------YTIQSLIDNSNVRVKIADLGNACYDYHHFTEDIQTRQYRSIEVL 882
            .|::|.:.:|           ...:|.:....:|.|.........:..|........|.....|.
  Fly   607 QQAKSGKTSTGGHGAGARERDLFGESYLPRPGLRKKATQSSLEVNNGSHADSLAPNAQKEKPAVA 671

  Fly   883 LGAPY---NYTADIWSTACLAFELATGDYLFDPH 913
            ...|:   |.|.|...||.:..|  .|:.:.|.|
  Fly   672 SSFPWDESNRTEDEKLTAWMVAE--NGNLILDNH 703

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Srpk79DNP_001246881.1 STKc_SRPK 336..>504 CDD:271038 47/218 (22%)
S_TKc 347..>492 CDD:214567 42/183 (23%)
STKc_SRPK <844..1012 CDD:271038 15/74 (20%)
CG42366NP_723501.2 STKc_MAK_like 4..284 CDD:270824 57/294 (19%)
S_TKc 4..284 CDD:214567 57/294 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24055
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.