DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Srpk79D and rl

Sequence 1:NP_001246881.1 Gene:Srpk79D FlyBaseID:FBgn0025702 Length:1018 Species:Drosophila melanogaster
Sequence 2:NP_001015122.1 Gene:rl FlyBaseID:FBgn0003256 Length:376 Species:Drosophila melanogaster

Alignment Length:188 Identity:56/189 (30%)
Similarity:80/189 (42%) Gaps:42/189 (22%)


  Fly   843 SLIDNSNVRVKIADLGNAC-----YDYHHF-TEDIQTRQYRSIEVLLGAP-YNYTADIWSTACLA 900
            :|:.|....:||.|.|.|.     :|:..| ||.:.||.||:.|::|.:. |..:.||||..|:.
  Fly   167 NLLLNKTCDLKICDFGLARIADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCIL 231

  Fly   901 FELATGDYLFDPHAGESYSRDEDHLAHIVELLGSIPQSVI--FRGKHGLKYFTSYGSLRNITKLK 963
            .|:.:...:|   .|:.|.   |.|.||:.:|||..:..:  ...:....|..|.....|:    
  Fly   232 AEMLSNRPIF---PGKHYL---DQLNHILGVLGSPSRDDLECIINEKARNYLESLPFKPNV---- 286

  Fly   964 PWSLMNVLVEKYDWDPVEAKKFS-------DFLLPMLEYNPVIRASAAECLQHPWLEQ 1014
            ||                ||.|.       |.|..||.:||..|....|.|.||:|||
  Fly   287 PW----------------AKLFPNADALALDLLGKMLTFNPHKRIPVEEALAHPYLEQ 328

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Srpk79DNP_001246881.1 STKc_SRPK 336..>504 CDD:271038
S_TKc 347..>492 CDD:214567
STKc_SRPK <844..1012 CDD:271038 53/184 (29%)
rlNP_001015122.1 STKc_ERK1_2_like 32..366 CDD:270839 56/189 (30%)
S_TKc 38..326 CDD:214567 53/185 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24055
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.