DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Srpk79D and CG8565

Sequence 1:NP_001246881.1 Gene:Srpk79D FlyBaseID:FBgn0025702 Length:1018 Species:Drosophila melanogaster
Sequence 2:NP_573080.1 Gene:CG8565 FlyBaseID:FBgn0030697 Length:790 Species:Drosophila melanogaster

Alignment Length:735 Identity:224/736 (30%)
Similarity:321/736 (44%) Gaps:213/736 (29%)


  Fly   310 DSSDSSLYVSDEEQEDASQYCRGGYHPVVIGDIFDNRFRVVRKLGWGHFSTVWLCRDLKDEKYVA 374
            |:::.|.:   :.||.|::|..||||||.|||:|.||:.|.:|||||||||||||.|.:.::|.|
  Fly   169 DNAEGSGF---DRQESANEYVIGGYHPVAIGDVFVNRYHVFKKLGWGHFSTVWLCYDTQMDRYCA 230

  Fly   375 LKVVKSAPHYIETAADEIRLLEAIRDADPMDVKRERIVRLMNHFTVRGVNGMHTCLVFEALGCSL 439
            :||.|||..|.||..|||.|...:...| ....|..:|...:.|.:.|.:|.|.|||.|.||.:|
  Fly   231 VKVSKSAQVYKETGIDEIMLFSQMSLHD-QHKYRSHVVGFYDFFEITGPHGRHICLVLEVLGDNL 294

  Fly   440 YKLIVKNNYQGLAIAQVRNIIRQVLEGLDYLHSKCSIIHTDIKPENILLVIDNAAAMNQQIDDEI 504
            .|:|.:..|:|:.|:.::.|.:|||.||.:||.:|.|||||:||||:||. .|..::..:|.   
  Fly   295 LKVIERCFYKGMPISNIKQIAQQVLTGLKFLHEECGIIHTDLKPENVLLA-SNEVSVRTEIK--- 355

  Fly   505 NSLRVKGVDFPDSYISSIEKQTKSRAKWPLIEPNGSTNTNTNTSNSTATNSNSSTPLAAVIMSTL 569
                           ::||...|:                         |....:|         
  Fly   356 ---------------TAIEVYLKA-------------------------NEGKLSP--------- 371

  Fly   570 DKEDTTTTTSSTLNSNTTSSLASKYSSLLGDSECNGGLGGSANINNRYRTEKKITAKSSGDCDED 634
                     ||.:.......:.:|                |..:.:.::..:::..:..   .||
  Fly   372 ---------SSKMTKTAKRRMQAK----------------SKKVISFFKNHRRMLRRQG---IED 408

  Fly   635 ----AESDTLGEQSTLASTMDSPTDLDPEPELDSKPNTVPEPSEGPIPEQPTPNSTNSSCPSHNT 695
                ||...: |..|.|..:.           |:.| .:|...:|.:      ..:::.|     
  Fly   409 LLYLAERGLI-EPITAAMAVS-----------DNLP-FIPFGFDGFM------MMSDADC----- 449

  Fly   696 ATIAKSKINSNILSTCTSLTSTNEYCFTNTNTTTASTPSAPPSATPSSAPALASATPPSTCTPSF 760
            .|:..||:..         ....||.....|                                  
  Fly   450 RTVQNSKLPE---------MEGMEYKCDRIN---------------------------------- 471

  Fly   761 TQIAPSATAPATSTTCTTSAEFY---------DGDHKTTSTST------------TTTSNA---- 800
                          .|..|.|.:         :.|.|..||..            .|..||    
  Fly   472 --------------LCLKSPELFLRYVLDIIKNLDEKELSTQDKRRRFTQASGRGQTKKNARSRL 522

  Fly   801 --ISSATTTTATTTTAIAKLNVHANAIPSQNQSQSSQNNTYTIQSLIDNSNVRVKIADLGNACYD 863
              .|:|..||.|...:..|:|:               |:.|.|....:..:|||||||||||||.
  Fly   523 RLASNAAYTTGTGWRSNRKINL---------------NDIYPIDPANNECDVRVKIADLGNACYF 572

  Fly   864 YHHFTEDIQTRQYRSIEVLLGAPYNYTADIWSTACLAFELATGDYLFDPHAGE-SYSRDEDHLAH 927
            :||||:||||::||::||:|||.|..||||||.|||.:|||||.||||.|:.. .|:.||.|:|.
  Fly   573 HHHFTDDIQTKEYRALEVILGAGYCETADIWSVACLLWELATGTYLFDTHSKRGKYNLDEVHIAK 637

  Fly   928 IVELLGSIPQSVIFRGKHGLKYFTSYGSLRNITKLKPWSLMNVLVEKYDWDPVEAKKFSDFLLPM 992
            |||..|.||..:|.:|||...:..|.|.|.||..|||..|.|:|:..|.|...::.:|.:||:||
  Fly   638 IVETCGRIPWYLIRKGKHSRNFINSAGKLCNIETLKPLKLANILIRWYGWRTRQSTEFVNFLMPM 702

  Fly   993 LEYNPVIRASAAECLQHPWL 1012
            |:.||:.|.||::.|:..:|
  Fly   703 LQTNPLSRISASKALESHYL 722

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Srpk79DNP_001246881.1 STKc_SRPK 336..>504 CDD:271038 78/168 (46%)
S_TKc 347..>492 CDD:214567 68/145 (47%)
STKc_SRPK <844..1012 CDD:271038 88/169 (52%)
CG8565NP_573080.1 PKc_like 192..722 CDD:304357 213/708 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1290
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S2039
OrthoDB 1 1.010 D290680at2759
OrthoFinder 1 1.000 FOG0000435
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24055
RoundUp 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.