DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Srpk79D and srpk1a

Sequence 1:NP_001246881.1 Gene:Srpk79D FlyBaseID:FBgn0025702 Length:1018 Species:Drosophila melanogaster
Sequence 2:NP_955944.1 Gene:srpk1a ZFINID:ZDB-GENE-030131-2399 Length:634 Species:Danio rerio

Alignment Length:742 Identity:272/743 (37%)
Similarity:373/743 (50%) Gaps:163/743 (22%)


  Fly   297 PRGTLS----TTDEIYPDSSDSSLYVSDEEQEDASQYCRGGYHPVVIGDIFDNRFRVVRKLGWGH 357
            |||...    .|:....:..:..|...||||||.:.||:||||.|.|||:.::::.|:|||||||
Zfish    28 PRGASQQQPPPTETQIQEPDEEILGSDDEEQEDPNDYCKGGYHHVKIGDLLNSKYHVIRKLGWGH 92

  Fly   358 FSTVWLCRDLKDEKYVALKVVKSAPHYIETAADEIRLLEAIRDADPMDVKRERIVRLMNHFTVRG 422
            ||||||..|::.:::||:||||||.||.|||.|||:||.::|:.||.|..||.:|:|::.|.:.|
Zfish    93 FSTVWLAWDIQGKRFVAMKVVKSAEHYTETALDEIKLLRSVRNTDPDDPNREMVVQLLDDFKISG 157

  Fly   423 VNGMHTCLVFEALGCSLYKLIVKNNYQGLAIAQVRNIIRQVLEGLDYLHSKCSIIHTDIKPENIL 487
            |||.|.|:|||.||..|.|.|:|:|||||.:..|::||||||:||||||:||.||||||||||||
Zfish   158 VNGTHVCMVFEVLGHHLLKWIIKSNYQGLPLPCVKSIIRQVLQGLDYLHTKCQIIHTDIKPENIL 222

  Fly   488 LVIDNAAAMNQQIDDEINSLRVKGVDFPDSYISSIEKQTKSRAKWPLIEPNGSTNTNTNTSNSTA 552
            :.::                        :.|:..:..:.....|.....|:||            
Zfish   223 MSVE------------------------ELYVRRLAAEATEWQKAGAPPPSGS------------ 251

  Fly   553 TNSNSSTPLAAVIMSTLDKEDTTTTTSSTLNSNTTSSLASKYSSLLGDSECNGGLGGSANINNRY 617
            ..|.:..|..|..|                                           |.|...:.
Zfish   252 AVSTAPAPKQAPKM-------------------------------------------SKNKKKKL 273

  Fly   618 RTEKKITAKSSGDCDEDAESDTLGEQSTLASTMDSPTDLDPEPELDSKPNTVPEPSEGPIPEQPT 682
            :.::|..|:....|..|.|...:|                               .||...|:..
Zfish   274 KKKQKRQAELLEKCIMDLEEMEIG-------------------------------PEGREEEEDD 307

  Fly   683 PNSTNS-SCPSHNTATIAKSKINSNILSTCTSLTSTNEYCFTNTNTTTASTPSAPPSATPSSAP- 745
            |.|..| ||.....|::.:......|:.|...||| :.....|.|....|:.:.|......... 
Zfish   308 PESPKSPSCAPLRQASLQEIATEDIIMDTRERLTS-DASVELNCNGCLHSSKTQPEEDEQGDLQY 371

  Fly   746 --------ALASATPPSTCTPSFTQIAPSATAPATSTTCTTSA-----EFYDGDHKTTSTSTTTT 797
                    ..|:|.|..| ..|..:....|.:|.....|.::.     :..||:        ..|
Zfish   372 GQLLQEDHHNANAGPEDT-AQSMYEYCNGAESPELDQACYSNGTSGQEQLEDGE--------LAT 427

  Fly   798 SNAISSATTTTATTTTAIAKLNVHANAIPSQNQSQSSQNNTYTIQSLIDN-------SNVRVKIA 855
            .......|.|.|.                .||:.: .:::..:..||:.|       ..::||||
Zfish   428 EEQHQQKTRTRAR----------------EQNKDK-IKDDKLSAGSLLVNPLDPLNADKIKVKIA 475

  Fly   856 DLGNACYDYHHFTEDIQTRQYRSIEVLLGAPYNYTADIWSTACLAFELATGDYLFDPHAGESYSR 920
            ||||||:.:.|||||||||||||:|||||:.||..||||||||:|||||||||||:||:||.|||
Zfish   476 DLGNACWVHKHFTEDIQTRQYRSLEVLLGSGYNTPADIWSTACMAFELATGDYLFEPHSGEDYSR 540

  Fly   921 DEDHLAHIVELLGSIPQSVIFRGKHGLKYFTSYGSLRNITKLKPWSLMNVLVEKYDWDPVEAKKF 985
            ||||:|.|:||||.:|:.::..||:..::|:..|.|::|||||||.|::||::||:|...||:.|
Zfish   541 DEDHIALIIELLGVVPRKLVLTGKYSKEFFSKKGDLKHITKLKPWGLLDVLMDKYEWPQEEAQTF 605

  Fly   986 SDFLLPMLEYNPVIRASAAECLQHPWL 1012
            |||||||||..|..||:||:||:||||
Zfish   606 SDFLLPMLELLPEKRATAADCLRHPWL 632

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Srpk79DNP_001246881.1 STKc_SRPK 336..>504 CDD:271038 93/168 (55%)
S_TKc 347..>492 CDD:214567 89/145 (61%)
STKc_SRPK <844..1012 CDD:271038 109/175 (62%)
srpk1aNP_955944.1 PKc_like 72..632 CDD:304357 254/697 (36%)
S_TKc 82..>224 CDD:214567 89/142 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1290
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D290680at2759
OrthoFinder 1 1.000 FOG0000435
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127107
Panther 1 1.100 O PTHR24055
Phylome 1 0.910 0.615 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
76.780

Return to query results.
Submit another query.