DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Srpk79D and Erk7

Sequence 1:NP_001246881.1 Gene:Srpk79D FlyBaseID:FBgn0025702 Length:1018 Species:Drosophila melanogaster
Sequence 2:NP_001188568.1 Gene:Erk7 FlyBaseID:FBgn0052703 Length:916 Species:Drosophila melanogaster

Alignment Length:601 Identity:132/602 (22%)
Similarity:219/602 (36%) Gaps:170/602 (28%)


  Fly   339 IGDIFDNRFRVVRKLGWGHFSTVWLCRDLKDEKYVALKVVKSAPHYIETAAD----EIRLLEAIR 399
            :..|||.|    :::|.|.:..||...|.:.:..||||.|..| ...||.|.    |:..|.|.|
  Fly    21 VESIFDVR----KRMGKGAYGIVWKATDRRTKNTVALKKVFDA-FRDETDAQRTYREVIFLRAFR 80

  Fly   400 DADPMDVKRERIVRLMNHFTVRGVNGMHTCLVFEALGCSLYKLIVKNNYQGLAIAQVRNIIRQVL 464
             ..|      .||||::.|  :..|.:...||||.:...|:.:|.:.|.  |.....|.::.|::
  Fly    81 -CHP------NIVRLVDIF--KASNNLDFYLVFEFMESDLHNVIKRGNV--LKDVHKRFVMYQLI 134

  Fly   465 EGLDYLHSKCSIIHTDIKPENILL-------VIDNAAA---MNQQIDDEINS-------LRVKGV 512
            ..:.::||. ::||.|:||.|||:       |.|...|   .:::|.|::..       :..:..
  Fly   135 NAIKFIHSG-NVIHRDLKPSNILIDSKCRLKVADFGLARTLSSRRIYDDLEQDGMLTDYVATRWY 198

  Fly   513 DFPDSYISSIEKQTKSRAKW-------------PLIEPNGSTNTN------TNTSNSTATNSNSS 558
            ..|:..::| ...||....|             ||.:  |::..|      |:..|.|..:..|.
  Fly   199 RAPEILVAS-RNYTKGIDMWGLGCILGEMIRQKPLFQ--GTSTVNQIEKIVTSLPNVTKLDIASI 260

  Fly   559 TP-LAAVIMS---------TLDK------EDTTTTTSSTLNSNTTSSLASK------------YS 595
            .| ..:|::|         :||:      :|..:...:.|..|..:.|.:|            |:
  Fly   261 GPSFGSVLLSRNIQRDRRYSLDEMMKNCCDDGISLVKALLVLNPHNRLTAKEAIRHPYVSRFQYA 325

  Fly   596 SLLGDSECNGGLGGSANINNRYRTEKKITAKSSGDCDE---------DAESDTLGEQSTLASTMD 651
            |  .:.:.:..:......:.||            |.|:         |.|: :...::...||..
  Fly   326 S--AEMDLHMDVVPPLKDHVRY------------DVDQYRNSLYELIDRET-SCSNRTVSNSTPS 375

  Fly   652 SPTDLDPEP---ELDSKPNTVPEPSEGPIPEQPTPNSTNSSCPSHNTATIAKSKINSNILSTCTS 713
            |..|..|:|   ...::..:..:|:..|...:..|:|..          :.:|:.|..:|.:...
  Fly   376 SNRDELPKPVRVTKQARTTSAKQPTTSPAERKKEPSSVE----------VTQSRKNIKLLGSAHK 430

  Fly   714 LTSTNEYCFTNTNTTTASTPSAPPSATPSSAPALASATPPSTCTPSFTQIAPSATAPATSTTCTT 778
            ..| .|.....:..|..|..||||:|.|.                     ||:|||||....   
  Fly   431 AQS-KEINHMESAITQVSIASAPPAAAPP---------------------APAATAPAVPRK--- 470

  Fly   779 SAEFYDGDHKTTSTSTTTTSNAISSATTTTATTTTAIAKLNVHANAIPSQNQSQS-SQNNTYT-- 840
                 .||   .|......:||.............|:|:..      .|..|||: ||...:|  
  Fly   471 -----SGD---KSVPKCQHNNAAVQRELAAVAAAAAVARRK------KSSWQSQAQSQGKFHTEA 521

  Fly   841 ---IQSLIDNSNVRVK 853
               :|:.|......:|
  Fly   522 KAHVQTAIQTQKDNIK 537

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Srpk79DNP_001246881.1 STKc_SRPK 336..>504 CDD:271038 54/179 (30%)
S_TKc 347..>492 CDD:214567 47/156 (30%)
STKc_SRPK <844..1012 CDD:271038 2/11 (18%)
Erk7NP_001188568.1 STKc_MAPK15-like 17..358 CDD:270841 83/371 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24055
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.