DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Srpk79D and Srpk2

Sequence 1:NP_001246881.1 Gene:Srpk79D FlyBaseID:FBgn0025702 Length:1018 Species:Drosophila melanogaster
Sequence 2:XP_017448002.1 Gene:Srpk2 RGDID:1305107 Length:723 Species:Rattus norvegicus

Alignment Length:753 Identity:295/754 (39%)
Similarity:398/754 (53%) Gaps:124/754 (16%)


  Fly   305 DEIYPDSSDSSLYVSDEEQEDASQYCRGGYHPVVIGDIFDNRFRVVRKLGWGHFSTVWLCRDLKD 369
            |.:.|:..:..|...||||||.:.||:||||||.|||:|:.|:.|:||||||||||||||.|::.
  Rat    48 DPVPPEPEEEILGSDDEEQEDPADYCKGGYHPVKIGDLFNGRYHVIRKLGWGHFSTVWLCWDMQG 112

  Fly   370 EKYVALKVVKSAPHYIETAADEIRLLEAIRDADPMDVKRERIVRLMNHFTVRGVNGMHTCLVFEA 434
            :::||:||||||.||.|||.|||:||:.:|::||.|..::.:|:|::.|.:.|:||:|.|:|||.
  Rat   113 KRFVAMKVVKSAQHYTETALDEIKLLKCVRESDPSDPNKDMVVQLIDDFKISGMNGIHVCMVFEV 177

  Fly   435 LGCSLYKLIVKNNYQGLAIAQVRNIIRQVLEGLDYLHSKCSIIHTDIKPENILLVIDNAAAMNQQ 499
            ||..|.|.|:|:|||||.:..|::||||||:|||||||||.||||||||||||:.:|.|..  ::
  Rat   178 LGHHLLKWIIKSNYQGLPVRCVKSIIRQVLQGLDYLHSKCKIIHTDIKPENILMCVDGAYV--RR 240

  Fly   500 IDDEINSLRVKGVDFPDSYISSIEKQTKSRAKWPLIEPNGSTNTNTNTSNSTATNSNSSTPLAAV 564
            :..|....:..|...|.....|...|.|         |.|..:.|............     |.:
  Rat   241 MAAEATEWQKAGAPPPSGSAVSTAPQQK---------PIGKISKNKKKKLKKKQKRQ-----AEL 291

  Fly   565 IMSTLD--KEDTTTTTSSTLNSNTTSSLASKYSSLLGDSECNGGLG-GSANINNRYRTEKKITAK 626
            :...|.  :|.........|..||||:.||...    |.||...:. ..|.:.:   |.::.|||
  Rat   292 LEKRLQEIEELEREAERKILEENTTSAEASSEQ----DGECQPEVKLKEAELED---TTEEETAK 349

  Fly   627 SSGDCDEDAESDTLGEQSTLASTMDSPTDLDPEPELDSKPNTVPEPSEGP-----------IPEQ 680
            .:|:.::..|.:...:::|     :...| |.|.||:   |..|...|.|           :.||
  Rat   350 DNGEVEDQEEKEDTEKENT-----EKDED-DVEQELE---NIDPTWMESPKANGHIENGLFLLEQ 405

  Fly   681 PTPNSTNSSCPSHNTATIAKSKINSNILSTCTSLTSTNEYCFTNTNTTTASTPSAPPSATPSSAP 745
            ...:..:......|.......:.|:.     :..|.::.|...|....... |.:|...||..:.
  Rat   406 QLEDEEDEEDDCANPEEYNLDEPNAE-----SDYTYSSSYEQFNGELPNGQ-PKSPEFPTPLFSG 464

  Fly   746 ALASATPPSTCTPSFTQIAPSATAPATSTTCTTSAEFYDGDHKTTSTSTTTTSNAISSATTTTAT 810
            .|......|..:.......|..::|:...:.|.||                      |:|.....
  Rat   465 PLEPVASDSVLSEGSPLTEPEESSPSRDRSRTVSA----------------------SSTGDLPK 507

  Fly   811 TTTAIAKLNVHANAIPSQNQSQSSQNNTYTIQSLIDNSNVRVKIADLGNACYDYHHFTEDIQTRQ 875
            |.|..|.|.|  |.:..||..:                 :|||||||||||:.:.||||||||||
  Rat   508 TKTRAADLLV--NPLDPQNADK-----------------IRVKIADLGNACWVHKHFTEDIQTRQ 553

  Fly   876 YRSIEVLLGAPYNYTADIWSTACLAFELATGDYLFDPHAGESYSRDEDHLAHIVELLGSIPQ--- 937
            |||||||:||.|:..||||||||:|||||||||||:||:||.|||||||:|||:|||||||:   
  Rat   554 YRSIEVLIGAGYSTPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIAHIIELLGSIPRHFA 618

  Fly   938 ----------------SVIFR------------GKHGLKYFTSYGSLRNITKLKPWSLMNVLVEK 974
                            ::|..            ||:..::||..|.||:|||||||||.:|||||
  Rat   619 LSGKYSREFFNRRDHIALIIELLGKVPRKYAMLGKYSKEFFTRKGELRHITKLKPWSLFDVLVEK 683

  Fly   975 YDWDPVEAKKFSDFLLPMLEYNPVIRASAAECLQHPWL 1012
            |.|...:|.:|:|||:||||..|..||||.|||:||||
  Rat   684 YGWPHEDAAQFTDFLIPMLEMVPEKRASAGECLRHPWL 721

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Srpk79DNP_001246881.1 STKc_SRPK 336..>504 CDD:271038 98/168 (58%)
S_TKc 347..>492 CDD:214567 89/145 (61%)
STKc_SRPK <844..1012 CDD:271038 115/199 (58%)
Srpk2XP_017448002.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1290
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D290680at2759
OrthoFinder 1 1.000 FOG0000435
OrthoInspector 1 1.000 T617536
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24055
Phylome 1 0.910 0.615 Consistency score
TreeFam 1 0.960
76.880

Return to query results.
Submit another query.