DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Srpk79D and Srpk3

Sequence 1:NP_001246881.1 Gene:Srpk79D FlyBaseID:FBgn0025702 Length:1018 Species:Drosophila melanogaster
Sequence 2:XP_006229620.1 Gene:Srpk3 RGDID:727856 Length:593 Species:Rattus norvegicus

Alignment Length:720 Identity:262/721 (36%)
Similarity:358/721 (50%) Gaps:194/721 (27%)


  Fly   309 PDSSDSSLYVS--------------DEEQEDASQYCRGGYHPVVIGDIFDNRFRVVRKLGWGHFS 359
            |:||.|.|..:              ||||||...||:|||:||.|||:|:.|:.|||||||||||
  Rat    50 PESSSSELAPATPAPRLLQGLLGSDDEEQEDPKDYCKGGYYPVKIGDLFNGRYHVVRKLGWGHFS 114

  Fly   360 TVWLCRDLKDEKYVALKVVKSAPHYIETAADEIRLLEAIRDADPMDVKRERIVRLMNHFTVRGVN 424
            |||||.|::.:::|||||||||.||.|||.|||:||:.:||:||.|.|||.||:|::.|.:.|||
  Rat   115 TVWLCWDIQRKRFVALKVVKSAGHYTETAVDEIKLLKCVRDSDPSDPKRETIVQLIDDFRISGVN 179

  Fly   425 GMH--TCLVFEALGCSLYKLIVKNNYQGLAIAQVRNIIRQVLEGLDYLHSKCSIIHTDIKPENIL 487
            |:.  .|:|.|.||..|.|.|:|:|||||.:..|::|:||||.||||||:||.||||||||||||
  Rat   180 GVRPDVCMVLEVLGHQLLKWIIKSNYQGLPVPCVKSIVRQVLHGLDYLHTKCKIIHTDIKPENIL 244

  Fly   488 LVIDNAAAMNQQIDDEINSLRVKGVDFPDSYISSIEKQTKSRAKWPLIEPNGSTNTNTNTSNSTA 552
            |.:.                        |:||..:                        .:.:|.
  Rat   245 LCVG------------------------DAYIRRL------------------------AAEATE 261

  Fly   553 TNSNSSTPLAAVIMSTLDKEDTTTTTSSTLNSNTTSSLASKYSSLLGDSECNGGLGGSANINNRY 617
            ...:.:.|.:...:||..:|...|   ..|:.|....:..|                       .
  Rat   262 WQQSGAQPPSRSTVSTAPQEVLQT---GKLSKNKRKKMRRK-----------------------R 300

  Fly   618 RTEKKITAKSSGDCDEDAESDTLGEQSTLASTMDSPTDLDPEPELDSKPNTVPEPSEGPIPEQPT 682
            :.:|::..:...|...      |........|.||.:.|                      ||.:
  Rat   301 KQQKRLLEERLRDLQR------LEAMEAAVQTEDSSSRL----------------------EQGS 337

  Fly   683 PNSTNSSCPSHNTATIAKSKINSNILSTCTSLTSTNEYCFTNTNTTTASTPSAPPSATPSSAPAL 747
            .::::|.|....|                                              .:.|:.
  Rat   338 GSTSSSGCHPEGT----------------------------------------------RAGPSP 356

  Fly   748 ASATPPSTCTPSFTQIAPSATAPATSTTCTTSAEFYDGDHKTTSTSTTTTSNAISSATTTTATTT 812
            ||::|           .|:....:.|.:..||.  :.|...:|::.:..:.::....|....:.:
  Rat   357 ASSSP-----------VPTGGERSLSPSSQTSG--FSGSLFSTASCSVLSGSSNQRETGGLLSPS 408

  Fly   813 TAIAKLNVHANAIPSQNQSQSSQNNTYTIQSLIDNSNVRVKIADLGNACYDYHHFTEDIQTRQYR 877
            |.....|:..|.:..||..:                 :::|||||||||:.:.||||||||||||
  Rat   409 TPFGASNLLVNPLEPQNADK-----------------IKIKIADLGNACWVHKHFTEDIQTRQYR 456

  Fly   878 SIEVLLGAPYNYTADIWSTACLAFELATGDYLFDPHAGESYSRDEDHLAHIVELLGSIPQSVIFR 942
            ::|||:||.|...||||||||:|||||||||||:||:||.|||||||:||||||||.||.:....
  Rat   457 AVEVLIGAEYGPPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIAHIVELLGDIPPAFALS 521

  Fly   943 GKHGLKYFTSYGSLRNITKLKPWSLMNVLVEKYDWDPVEAKKFSDFLLPMLEYNPVIRASAAECL 1007
            |::..::|...|.||:|..||.|.|..||:|||:|...:|.:||.|||||:||.|..|||||:||
  Rat   522 GRYSREFFNRRGELRHIHNLKHWGLYEVLMEKYEWPLEQATQFSAFLLPMMEYIPEKRASAADCL 586

  Fly  1008 QHPWL 1012
            |||||
  Rat   587 QHPWL 591

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Srpk79DNP_001246881.1 STKc_SRPK 336..>504 CDD:271038 100/170 (59%)
S_TKc 347..>492 CDD:214567 93/147 (63%)
STKc_SRPK <844..1012 CDD:271038 105/168 (63%)
Srpk3XP_006229620.1 PKc_like 91..591 CDD:304357 245/678 (36%)
S_TKc 102..591 CDD:214567 238/667 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D290680at2759
OrthoFinder 1 1.000 FOG0000435
OrthoInspector 1 1.000 T617536
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24055
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.110

Return to query results.
Submit another query.