DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Srpk79D and SRPK3

Sequence 1:NP_001246881.1 Gene:Srpk79D FlyBaseID:FBgn0025702 Length:1018 Species:Drosophila melanogaster
Sequence 2:NP_055185.2 Gene:SRPK3 HGNCID:11402 Length:567 Species:Homo sapiens

Alignment Length:720 Identity:271/721 (38%)
Similarity:360/721 (50%) Gaps:197/721 (27%)


  Fly   309 PDSSDSSLYVS--------------DEEQEDASQYCRGGYHPVVIGDIFDNRFRVVRKLGWGHFS 359
            |:||.|.|.::              ||||||...||:||||||.|||:|:.|:.|||||||||||
Human    27 PESSGSELALATPVPQMLQGLLGSDDEEQEDPKDYCKGGYHPVKIGDVFNGRYHVVRKLGWGHFS 91

  Fly   360 TVWLCRDLKDEKYVALKVVKSAPHYIETAADEIRLLEAIRDADPMDVKRERIVRLMNHFTVRGVN 424
            |||||.|::.:::|||||||||.||.|||.|||:||:.:||:||.|.|||.||:|::.|.:.|||
Human    92 TVWLCWDIQRKRFVALKVVKSAGHYTETAVDEIKLLKCVRDSDPSDPKRETIVQLIDDFRISGVN 156

  Fly   425 GMHTCLVFEALGCSLYKLIVKNNYQGLAIAQVRNIIRQVLEGLDYLHSKCSIIHTDIKPENILLV 489
            |:|.|:|.|.||..|.|.|:|:|||||.:..|::|:||||.||||||:||.|||||||||||||.
Human   157 GVHVCMVLEVLGHQLLKWIIKSNYQGLPVPCVKSIVRQVLHGLDYLHTKCKIIHTDIKPENILLC 221

  Fly   490 IDNAAAMNQQIDDEINSLRVKGVDFPDSYISSIEKQTKSRAKWPLIEPNGSTNTNTNTSNSTATN 554
            :.                        |:||..:                        .:.:|...
Human   222 VG------------------------DAYIRRL------------------------AAEATEWQ 238

  Fly   555 SNSSTPLAAVIMSTLDKEDTTTTTSSTLNSNTTSSLASKYSSLLGDSECNGGLGGSANINNRYRT 619
            ...:.|.:..|:||..:|...|   ..|:.|....:..|                       .:.
Human   239 QAGAPPPSRSIVSTAPQEVLQT---GKLSKNKRKKMRRK-----------------------RKQ 277

  Fly   620 EKKITAKSSGDCD--EDAESDTLGEQSTLASTMDSPTDLDPEPELDSKPNTVPEPSEGPIPEQPT 682
            :|::..:...|..  |..|:.|..|.|.|              .||.                .:
Human   278 QKRLLEERLRDLQRLEAMEAATQAEDSGL--------------RLDG----------------GS 312

  Fly   683 PNSTNSSCPSHNTATIAKSKINSNILSTCTSLTSTNEYCFTNTNTTTASTPSAPPSATPSSAPAL 747
            .::::|.|  |                                   .....:.|..|:.|.||..
Human   313 GSTSSSGC--H-----------------------------------PGGARAGPSPASSSPAPGG 340

  Fly   748 ASATPPSTCTPSFTQIAPSATAPATSTTCTTSAEFYDGDHKTTSTSTTTTSNAISSATTTTATTT 812
            ..:....:.|..|   :.|..:||       |.....|     |::...|...:|.:|...|:  
Human   341 GRSLSAGSQTSGF---SGSLFSPA-------SCSILSG-----SSNQRETGGLLSPSTPFGAS-- 388

  Fly   813 TAIAKLNVHANAIPSQNQSQSSQNNTYTIQSLIDNSNVRVKIADLGNACYDYHHFTEDIQTRQYR 877
                  |:..|.:..||..:                 :::|||||||||:.:.||||||||||||
Human   389 ------NLLVNPLEPQNADK-----------------IKIKIADLGNACWVHKHFTEDIQTRQYR 430

  Fly   878 SIEVLLGAPYNYTADIWSTACLAFELATGDYLFDPHAGESYSRDEDHLAHIVELLGSIPQSVIFR 942
            ::|||:||.|...||||||||:|||||||||||:||:||.|||||||:||||||||.||.:....
Human   431 AVEVLIGAEYGPPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIAHIVELLGDIPPAFALS 495

  Fly   943 GKHGLKYFTSYGSLRNITKLKPWSLMNVLVEKYDWDPVEAKKFSDFLLPMLEYNPVIRASAAECL 1007
            |::..::|...|.||:|..||.|.|..||:|||:|...:|.:||.|||||:||.|..|||||:||
Human   496 GRYSREFFNRRGELRHIHNLKHWGLYEVLMEKYEWPLEQATQFSAFLLPMMEYIPEKRASAADCL 560

  Fly  1008 QHPWL 1012
            |||||
Human   561 QHPWL 565

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Srpk79DNP_001246881.1 STKc_SRPK 336..>504 CDD:271038 101/168 (60%)
S_TKc 347..>492 CDD:214567 94/145 (65%)
STKc_SRPK <844..1012 CDD:271038 105/168 (63%)
SRPK3NP_055185.2 STKc_SRPK3 68..565 CDD:271120 253/678 (37%)
S_TKc 79..565 CDD:214567 246/667 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1290
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S2039
OMA 1 1.010
OrthoDB 1 1.010 D290680at2759
OrthoFinder 1 1.000 FOG0000435
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127107
Panther 1 1.100 O PTHR24055
Phylome 1 0.910 0.643 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
98.740

Return to query results.
Submit another query.