DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Srpk79D and dsk1

Sequence 1:NP_001246881.1 Gene:Srpk79D FlyBaseID:FBgn0025702 Length:1018 Species:Drosophila melanogaster
Sequence 2:NP_595327.1 Gene:dsk1 PomBaseID:SPBC530.14c Length:544 Species:Schizosaccharomyces pombe

Alignment Length:702 Identity:217/703 (31%)
Similarity:292/703 (42%) Gaps:249/703 (35%)


  Fly   323 QEDASQYCRGGYHPVVIGDIFDNRFRVV-RKLGWGHFSTVWLCRDLKDEKYVALKVVKSAPHYIE 386
            :|:|..|..||||||.||:.|.:|..|| |||||||||||||..|...::.||||||:||.||.|
pombe    56 EENAEDYHYGGYHPVYIGEEFHHRRYVVERKLGWGHFSTVWLAYDRAAKRRVALKVVRSAEHYRE 120

  Fly   387 TAADEIRLLEAIRDADPMDVKRERIVRLMNHFTVRGVNGMHTCLVFEALGCSLYKLIVKNNYQGL 451
            |:.||||:|:.||:.|...:.::.|:.|:::|..||.||.|.|:|||.||.:|..||....::|:
pombe   121 TSIDEIRILQKIREGDEKHLGKKHIISLLDYFVHRGPNGAHVCMVFEVLGENLLSLIQSYGHRGV 185

  Fly   452 AIAQVRNIIRQVLEGLDYLHSKCSIIHTDIKPENILLVIDNAAAMNQQIDDEINSLRVKGVDFPD 516
            .:..|:.|..|:|..|||||.:|.|||||:||||:|:.||..|..:                   
pombe   186 PVGIVKQIAYQLLIALDYLHRECGIIHTDLKPENVLICIDQDALQH------------------- 231

  Fly   517 SYISSIEKQTKSRAKWPLIEPNGSTNTNT-NTSNSTATNSNSSTPLAAVIMSTLDKEDTTTTTSS 580
                              ||...:|::.| |||:|...|:...|..|.:|               
pombe   232 ------------------IEAPATTSSPTSNTSSSKTRNNTGYTAKAPII--------------- 263

  Fly   581 TLNSNTTSSLASKYSSLLGDSECNGGLGGSANINNRYRTEKKITAKSSGDCDEDAESDTLGEQST 645
                                                         |.....|..|:     |:.|
pombe   264 ---------------------------------------------KRGQSVDNSAQ-----ERKT 278

  Fly   646 LASTMDSPTDLDPEPELDSKPNTVPEPSEGPIPEQPTPNSTNSSCPSHNTATIAKSKINSNILST 710
            .|.          .|..:|||       .|.:                                 
pombe   279 FAK----------NPTKNSKP-------AGQV--------------------------------- 293

  Fly   711 CTSLTSTNEYCFTNTNTTTASTPSAPPSATPSSAPALASATPPSTCTPSFTQIAPSATAPATSTT 775
                                 .||:|.::|.|..|:|..|....:...|                
pombe   294 ---------------------IPSSPFTSTLSRFPSLEGAVSEISLRDS---------------- 321

  Fly   776 CTTSAEFYDGDHKTTSTSTTTTSNAISSATTTTATTTTAIAKLNVHANAIPSQNQSQSSQNNTYT 840
                                                    .|.|.|.|:      ..||.:|:. 
pombe   322 ----------------------------------------QKHNSHPNS------PFSSGDNSL- 339

  Fly   841 IQSLIDNSN--------VRVKIADLGNACYDYHHFTEDIQTRQYRSIEVLLGAPYNYTADIWSTA 897
               ::|..|        :.||||||||||:...|||.|:|||||||.||:||..:..:||.||.|
pombe   340 ---ILDGVNGSQEPVPKITVKIADLGNACWTRKHFTNDVQTRQYRSPEVILGCRWGASADCWSFA 401

  Fly   898 CLAFELATGDYLFDPHAGESYSRDEDHLAHIVELLGSIPQSVIFRGKHGLKYFTSYGSLRNITKL 962
            |:.|||.||||||||..|.|||:::||:|.|:|||.:.|:.:...|||....|...|.||||.||
pombe   402 CIIFELLTGDYLFDPRNGNSYSKEDDHIAQIIELLVNYPKQMALSGKHSRDLFNRRGELRNIHKL 466

  Fly   963 KPWSLMNVLVEKYDWDPVEAKKFSDFLLPMLEYNPVIRASAAECLQHPWLEQ 1014
            |.|.|.:||.:||.:....|::.||||.|||.::|..|.:|......|||.:
pombe   467 KFWPLKDVLEQKYHFSAELAQQISDFLSPMLCFDPAKRTNAGYMSNSPWLRE 518

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Srpk79DNP_001246881.1 STKc_SRPK 336..>504 CDD:271038 83/169 (49%)
S_TKc 347..>492 CDD:214567 76/146 (52%)
STKc_SRPK <844..1012 CDD:271038 87/176 (49%)
dsk1NP_595327.1 STKc_SRPK 69..516 CDD:271038 209/686 (30%)
S_TKc 81..516 CDD:214567 203/674 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 349 1.000 Inparanoid score I476
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000435
OrthoInspector 1 1.000 T631340
orthoMCL 1 0.900 OOG5_127107
Panther 1 1.100 O PTHR24055
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
98.930

Return to query results.
Submit another query.