DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Srpk79D and Srpk2

Sequence 1:NP_001246881.1 Gene:Srpk79D FlyBaseID:FBgn0025702 Length:1018 Species:Drosophila melanogaster
Sequence 2:XP_011248053.1 Gene:Srpk2 MGIID:1201408 Length:750 Species:Mus musculus

Alignment Length:805 Identity:296/806 (37%)
Similarity:407/806 (50%) Gaps:156/806 (19%)


  Fly   270 LSLSLSPPLNRRRDMPALRGPFV-SLSEPRGTLSTTDEIYPDSSDSSLYVSDEEQEDASQYCRGG 333
            :|::.....:..|..|..:.|.| ....|.......|...|:..:..|...||||||.:.||:||
Mouse    38 MSVNSEKSSSSERPEPQQKAPLVPPPPPPPPPPPLPDPAPPEPEEEILGSDDEEQEDPADYCKGG 102

  Fly   334 YHPVVIGDIFDNRFRVVRKLGWGHFSTVWLCRDLKDEKYVALKVVKSAPHYIETAADEIRLLEAI 398
            ||||.|||:|:.|:.|:||||||||||||||.|::.:::||:||||||.||.|||.|||:||:.:
Mouse   103 YHPVKIGDLFNGRYHVIRKLGWGHFSTVWLCWDMQGKRFVAMKVVKSAQHYTETALDEIKLLKCV 167

  Fly   399 RDADPMDVKRERIVRLMNHFTVRGVNGMHTCLVFEALGCSLYKLIVKNNYQGLAIAQVRNIIRQV 463
            |::||.|..::.:|:|::.|.:.|:||:|.|:|||.||..|.|.|:|:|||||.:..|::|||||
Mouse   168 RESDPSDPNKDMVVQLIDDFKISGMNGIHVCMVFEVLGHHLLKWIIKSNYQGLPVRCVKSIIRQV 232

  Fly   464 LEGLDYLHSKCSIIHTDIKPENILLVIDNAAAMNQQIDDEINSLRVKGVDFPDSYISSIEKQTKS 528
            |:|||||||||.||||||||||||:.:|:|..  :::..|....:..|...|.....|...|.| 
Mouse   233 LQGLDYLHSKCKIIHTDIKPENILMCVDDAYV--RRMAAEATEWQKAGAPPPSGSAVSTAPQQK- 294

  Fly   529 RAKWPLIEPNGSTNTNTNTSNSTATNSNSSTPLAAVIMSTLD--KEDTTTTTSSTLNSNTTSSLA 591
                    |.|..:.|............     |.::...|.  :|.........|..|.||:.|
Mouse   295 --------PIGKISKNKKKKLKKKQKRQ-----AELLEKRLQEIEELEREAERKILEENITSAEA 346

  Fly   592 SKYSSLLGDSECNGGLGGSANINNRYRTEKKITAKSSGDCDEDAESDTLGEQSTLASTMDSPTDL 656
            |      |:.:           :..|:.|  :|.|:: |.::..|.:|..:...:.         
Mouse   347 S------GEQQ-----------DGEYQPE--VTLKAA-DLEDTTEEETAKDNGEVE--------- 382

  Fly   657 DPEPELDSKPNTVPEPSEGPIPEQPTPNSTNSSCPSHNTATIAKSKINSNILSTCTSL------T 715
            |.|.:.|::.... |..|..: ||...|.        :...:...|.|.:|.:...||      .
Mouse   383 DQEEKEDAEKENA-EKDEDDV-EQELANL--------DPTWVESPKANGHIENGPFSLEQQLEDE 437

  Fly   716 STNEYCFTNTNTTTASTPSAPPSATPSSAPALASATPPSTCTPSFTQIAPSATAPATSTTCTTSA 780
            ..:|....|........|:|....|.||               |:.|.               :.
Mouse   438 EDDEDDCANPEEYNLDEPNAESDYTYSS---------------SYEQF---------------NG 472

  Fly   781 EFYDGDHKTTSTSTTTTSNAISSATTTTATTTTAIAKLNVHANAIPSQNQSQSSQNNTYTIQS-- 843
            |..:|.|||:...|...|..:.         ..|...:....:.:..|.:|..|.:.:.|:.:  
Mouse   473 ELPNGQHKTSEFPTPLFSGPLE---------PVACGSVISEGSPLTEQEESSPSHDRSRTVSASS 528

  Fly   844 -------------LIDN-------SNVRVKIADLGNACYDYHHFTEDIQTRQYRSIEVLLGAPYN 888
                         |:.|       ..:|||||||||||:.:.|||||||||||||||||:||.|:
Mouse   529 TGDLPKTKTRAADLLVNPLDPRNADKIRVKIADLGNACWVHKHFTEDIQTRQYRSIEVLIGAGYS 593

  Fly   889 YTADIWSTACLAFELATGDYLFDPHAGESYSRDEDHLAHIVELLGSIPQ---------------- 937
            ..||||||||:|||||||||||:||:||.|||||||:|||:|||||||:                
Mouse   594 TPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIAHIIELLGSIPRHFALSGKYSREFFNRR 658

  Fly   938 ---SVIFR------------GKHGLKYFTSYGSLRNITKLKPWSLMNVLVEKYDWDPVEAKKFSD 987
               ::|..            ||:..::||..|.||:|||||||||.:||||||.|...:|.:|:|
Mouse   659 DHIALIIELLGKVPRKYAMLGKYSKEFFTRKGELRHITKLKPWSLFDVLVEKYGWPHEDAAQFTD 723

  Fly   988 FLLPMLEYNPVIRASAAECLQHPWL 1012
            ||:||||..|..||||.|||:||||
Mouse   724 FLIPMLEMVPEKRASAGECLRHPWL 748

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Srpk79DNP_001246881.1 STKc_SRPK 336..>504 CDD:271038 98/168 (58%)
S_TKc 347..>492 CDD:214567 89/145 (61%)
STKc_SRPK <844..1012 CDD:271038 117/206 (57%)
Srpk2XP_011248053.1 STKc_SRPK2 103..>291 CDD:271119 103/190 (54%)
S_TKc 116..>260 CDD:214567 88/144 (61%)
Ribosomal_L24e_L24 <338..405 CDD:294589 20/98 (20%)
PKc_like <537..748 CDD:304357 117/211 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1290
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000435
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127107
Panther 1 1.100 O PTHR24055
Phylome 1 0.910 0.615 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.780

Return to query results.
Submit another query.