DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Srpk79D and Srpk1

Sequence 1:NP_001246881.1 Gene:Srpk79D FlyBaseID:FBgn0025702 Length:1018 Species:Drosophila melanogaster
Sequence 2:NP_058075.2 Gene:Srpk1 MGIID:106908 Length:648 Species:Mus musculus

Alignment Length:729 Identity:281/730 (38%)
Similarity:393/730 (54%) Gaps:121/730 (17%)


  Fly   295 SEPRGTLSTTDEIYPDSSDSSLYVSDEEQEDASQYCRGGYHPVVIGDIFDNRFRVVRKLGWGHFS 359
            ::.||:...::...|:..:..|...|:||||.:.||:||||.|.|||:|:.|:.|:|||||||||
Mouse    28 TQHRGSAPHSESDIPEQEEEILGSDDDEQEDPNDYCKGGYHLVKIGDLFNGRYHVIRKLGWGHFS 92

  Fly   360 TVWLCRDLKDEKYVALKVVKSAPHYIETAADEIRLLEAIRDADPMDVKRERIVRLMNHFTVRGVN 424
            ||||..|::.:|:||:||||||.||.|||.||||||:::|::||.|...|.:|:|::.|.:.|||
Mouse    93 TVWLSWDIQGKKFVAMKVVKSAEHYTETALDEIRLLKSVRNSDPNDPNGEMVVQLLDDFKISGVN 157

  Fly   425 GMHTCLVFEALGCSLYKLIVKNNYQGLAIAQVRNIIRQVLEGLDYLHSKCSIIHTDIKPENILLV 489
            |.|.|:|||.||..|.|.|:|:|||||.:..|:.||:|||:||||||:||.||||||||||||| 
Mouse   158 GTHICMVFEVLGHHLLKWIIKSNYQGLPLPCVKKIIQQVLQGLDYLHTKCRIIHTDIKPENILL- 221

  Fly   490 IDNAAAMNQQIDDEINSLRVKGVDFPDSYISSIEKQTKSRAKWPLIEPNGSTNTNTNTSNSTATN 554
                 ::|:|                  ||..:..:.....:.....|:||       :.|||..
Mouse   222 -----SVNEQ------------------YIRRLAAEATEWQRSGAPPPSGS-------AVSTAPQ 256

  Fly   555 SNSSTPLAAVIMSTLDKEDTTTTTSSTLNSNTTSSLASKYSSLLGDSECNGGLGGSANINNRYRT 619
            ...:..::......|.|:           ....:.|..|....:.:.|...| .|....|.:..:
Mouse   257 PKPADKMSKNKKKKLKKK-----------QKRQAELLEKRMQEIEEMEKESG-PGQKRPNKQEES 309

  Fly   620 E----KKITAKSSGDCDED--AESDTLGEQSTLASTMDSPTDLDPE---PELDSKPNTVPEPSEG 675
            |    :.:|........::  .||:::|:..||       |:...|   ||::         ..|
Mouse   310 ESPVDRPLTENPPNKMTQEKLEESNSIGQDQTL-------TERGGEGGAPEIN---------CNG 358

  Fly   676 PIPEQPTPNSTNSSCPSHNTATIAKSKINSNILSTCTSLTSTNEYCFTNTNTTTASTPSAPPSAT 740
            .|.....|.::|:....|.     :...|:|   .|...|...|..|.|::...:|......|.|
Mouse   359 VIGVVNYPENSNNETLRHK-----EDLHNAN---DCDVHTLKQEPSFLNSSNGDSSPSQDTDSCT 415

  Fly   741 PSSAPALA--SATPPSTCTPSFTQIAPSATAPATSTTCTTSAEFYDGDHKTTSTSTTTTSNAISS 803
            |:::..:.  |:...|......||:..|..|...|           ||.:       ..:.|:.|
Mouse   416 PTASETMVCQSSAEQSLTRQDITQLEESIRADTPS-----------GDEQ-------EPNGALDS 462

  Fly   804 ATTTTATTTTAIAKLNVHANAIPSQNQSQSSQNNTYTIQSLIDNSNVRVKIADLGNACYDYHHFT 868
            ....:|.        |...|.:..:|..:                 ::||||||||||:.:.|||
Mouse   463 KGKFSAG--------NFLINPLEPKNAEK-----------------LQVKIADLGNACWVHKHFT 502

  Fly   869 EDIQTRQYRSIEVLLGAPYNYTADIWSTACLAFELATGDYLFDPHAGESYSRDEDHLAHIVELLG 933
            ||||||||||:|||:|:.||..||||||||:|||||||||||:||:||.|:|||||:|.|:||||
Mouse   503 EDIQTRQYRSLEVLIGSGYNTPADIWSTACMAFELATGDYLFEPHSGEDYTRDEDHIALIIELLG 567

  Fly   934 SIPQSVIFRGKHGLKYFTSYGSLRNITKLKPWSLMNVLVEKYDWDPVEAKKFSDFLLPMLEYNPV 998
            .:|:.:|..||:..::||..|.|::|||||||.|:.||||||:|...||..|:||||||||..|.
Mouse   568 KVPRKLIVAGKYSKEFFTKKGDLKHITKLKPWGLLEVLVEKYEWPQEEAAGFTDFLLPMLELMPE 632

  Fly   999 IRASAAECLQHPWL 1012
            .||:|||||:||||
Mouse   633 KRATAAECLRHPWL 646

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Srpk79DNP_001246881.1 STKc_SRPK 336..>504 CDD:271038 98/168 (58%)
S_TKc 347..>492 CDD:214567 90/145 (62%)
STKc_SRPK <844..1012 CDD:271038 109/168 (65%)
Srpk1NP_058075.2 PKc_like 70..646 CDD:304357 265/686 (39%)
S_TKc 80..>224 CDD:214567 90/150 (60%)
PKc_like <469..>545 CDD:304357 51/101 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1290
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D290680at2759
OrthoFinder 1 1.000 FOG0000435
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24055
Phylome 1 0.910 0.630 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.890

Return to query results.
Submit another query.