DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Srpk79D and ZK228.4

Sequence 1:NP_001246881.1 Gene:Srpk79D FlyBaseID:FBgn0025702 Length:1018 Species:Drosophila melanogaster
Sequence 2:NP_001123078.1 Gene:ZK228.4 WormBaseID:WBGene00013947 Length:309 Species:Caenorhabditis elegans

Alignment Length:102 Identity:22/103 (21%)
Similarity:42/103 (41%) Gaps:28/103 (27%)


  Fly   309 PDSSDSSLYVSDEEQEDASQYCRGGYHPVVIGDIFD------NRFRVVRKLGWGH----FSTVWL 363
            |.:.||.:.|.|.::.|.:|.           :.:|      ||.:::|  .|..    ::.|.:
 Worm   148 PKNLDSDVIVKDWKEVDEAQL-----------EAYDLTICSRNRKKIMR--NWFQQDEVYTRVAI 199

  Fly   364 CRDLKDEKYVALKVV-----KSAPHYIETAADEIRLL 395
            ..:.|...|..::||     :::|.|.|......:||
 Worm   200 DSNQKIVGYCTIRVVNLNRIRASPFYAENGEIAAKLL 236

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Srpk79DNP_001246881.1 STKc_SRPK 336..>504 CDD:271038 15/76 (20%)
S_TKc 347..>492 CDD:214567 12/59 (20%)
STKc_SRPK <844..1012 CDD:271038
ZK228.4NP_001123078.1 RimL <34..>125 CDD:224584
NAT_SF 54..103 CDD:173926
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1290
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.