DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Srpk79D and spk-1

Sequence 1:NP_001246881.1 Gene:Srpk79D FlyBaseID:FBgn0025702 Length:1018 Species:Drosophila melanogaster
Sequence 2:NP_499080.3 Gene:spk-1 WormBaseID:WBGene00004980 Length:1003 Species:Caenorhabditis elegans

Alignment Length:812 Identity:267/813 (33%)
Similarity:361/813 (44%) Gaps:226/813 (28%)


  Fly   226 TSSQST--------TKLSYRDDFLQQIGYLPTTRIYSTPTSIVDEDKAQQDFLSLSLSPPLNRRR 282
            |||.||        |.....|..:|...|...|...|...||...          |:.|..|::.
 Worm   294 TSSSSTGDDGDDSATSYDSEDIEIQMFEYDLGTACASASISIPRP----------SIIPRNNKKT 348

  Fly   283 DMPALRGPFVSLS-------EPRGTLSTTDEIYPDSSD--SSLYVSDEEQEDASQYCRGGYHPVV 338
            ::.|.......||       .|.|......:.:.|..|  ..|...||||||...|.|||||||.
 Worm   349 EVNANEERLDDLSVSPGRSDSPGGGGGGHSDSFQDPMDPGEQLGSDDEEQEDPRDYKRGGYHPVN 413

  Fly   339 IGDIFDNRFRVVRKLGWGHFSTVWLCRDLKDEKYVALKVVKSAPHYIETAADEIRLLEAIRDADP 403
            |||:|:.|:.|:|||||||||||||..|.:|:::||:|:||||.||.|.|.|||:||.::|.|||
 Worm   414 IGDVFNARYHVIRKLGWGHFSTVWLAWDTQDKRFVAMKIVKSAEHYTEAALDEIKLLLSVRSADP 478

  Fly   404 MDVKRERIVRLMNHFTVRGVNGMHTCLVFEALGCSLYKLIVKNNYQGLAIAQVRNIIRQVLEGLD 468
            .|:...::|:|::.|||.|:||.|..:|||.|||:|.|||:::||:||.:.|||.|.|||||.|.
 Worm   479 NDIGCHKVVQLLDEFTVTGINGQHVAMVFEVLGCNLLKLIIRSNYRGLHLEQVRKICRQVLEALG 543

  Fly   469 YLHSKCSIIHTDIKPENILLVIDNAAAMNQQIDDEINSLRVKGVDFPDSYISSIEKQTKSRAKWP 533
            |:|.||.||||||||||:|:                                     |.||.:..
 Worm   544 YMHEKCGIIHTDIKPENVLI-------------------------------------TMSREEIK 571

  Fly   534 LIEPNGSTNTNTNTSNSTATNSNSSTPLAAVIMSTLDKEDTTTTTSSTLNSNTTSSLASKYSSLL 598
            ::..:.......|...|.:..|.:...|..:....:.|             |....:..|..   
 Worm   572 IMAQHAVVARKMNMKMSGSAVSTAPDHLVKMAQENMTK-------------NKKKKMKKKAK--- 620

  Fly   599 GDSECNGGLGGSANINNRYRTEKKITAKSSGDCDEDAESDTLGEQSTLASTMDSPTDLDPEPELD 663
                               :..:|:.|:.:|  .|..:.|..|.|....:.          |||:
 Worm   621 -------------------KQREKLEAELAG--LEGLKMDANGLQEAYNNA----------PELE 654

  Fly   664 S-KPNTVPEPS-EGPIPEQPTPNSTNSSCPSHNTATIAKSKINSNILSTCTSLTSTNEYCFTNTN 726
            : ..:.|.:.: |..:.|....|......|..                            |..|.
 Worm   655 NFNASQVEDVTMEDTVNENGNRNKVEIRSPDR----------------------------FDRTT 691

  Fly   727 TTTASTPS------APPSATPSSAPALASATPPSTCTPSFTQIAPSATAPATSTTCTTSAEFYDG 785
            .|..|.|.      |.|||...|:|              .:|:.|....||..........:.|.
 Worm   692 LTPFSDPESKFGDLASPSAEYLSSP--------------MSQLPPGGILPAPPVGPNIGDPYCDI 742

  Fly   786 DHKTTSTSTTTTSNAISSATTTTATTTTAIAKLNVHANAIPSQNQSQSSQNNTYTIQSLIDNSNV 850
            |                                                                
 Worm   743 D---------------------------------------------------------------- 743

  Fly   851 RVKIADLGNACYDYHHFTEDIQTRQYRSIEVLLGAPYNYTADIWSTACLAFELATGDYLFDPHAG 915
             ||||||||||:..||:|:||||||||::|||:|:.|...||||||||:|||||||||||:||.|
 Worm   744 -VKIADLGNACWVNHHYTDDIQTRQYRALEVLIGSGYGPPADIWSTACMAFELATGDYLFEPHQG 807

  Fly   916 ESYSRDEDHLAHIVELLGSIPQSVIFRGKHGLKYFTSYGSLRNITKLKPWSLMNVLVEKYDWDPV 980
            ::|||||||||||.||||:||.|:..:|||..::|...|.|.:|.:||||||..||.:||:|...
 Worm   808 DNYSRDEDHLAHISELLGAIPPSIYKKGKHWREFFHKNGHLLHIHQLKPWSLYEVLRQKYEWSHE 872

  Fly   981 EAKKFSDFLLPMLEYNPVIRASAAECLQHPWL 1012
            :|::|..||.|||:::...|::|...|:||:|
 Worm   873 DAQQFESFLRPMLDFDQEKRSTAKIALKHPFL 904

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Srpk79DNP_001246881.1 STKc_SRPK 336..>504 CDD:271038 92/168 (55%)
S_TKc 347..>492 CDD:214567 85/145 (59%)
STKc_SRPK <844..1012 CDD:271038 96/168 (57%)
spk-1NP_499080.3 STKc_SRPK 411..904 CDD:271038 230/684 (34%)
S_TKc 422..904 CDD:214567 223/673 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 415 1.000 Inparanoid score I1017
Isobase 1 0.950 0 Normalized mean entropy S2039
OMA 1 1.010
OrthoDB 1 1.010 D290680at2759
OrthoFinder 1 1.000 FOG0000435
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127107
Panther 1 1.100 O PTHR24055
Phylome 1 0.910 0.643 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.930

Return to query results.
Submit another query.