DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Srpk79D and srpk2

Sequence 1:NP_001246881.1 Gene:Srpk79D FlyBaseID:FBgn0025702 Length:1018 Species:Drosophila melanogaster
Sequence 2:XP_021326235.1 Gene:srpk2 ZFINID:ZDB-GENE-131105-1 Length:817 Species:Danio rerio

Alignment Length:826 Identity:307/827 (37%)
Similarity:409/827 (49%) Gaps:173/827 (21%)


  Fly   296 EPRGTLSTTDEIYPDSSDSSLYVSDEEQEDASQYCRGGYHPVVIGDIFDNRFRVVRKLGWGHFST 360
            ||...|...:||.  .||      ||||||.:.||:||||||.|||:|::.:.|:||||||||||
Zfish    54 EPVAPLEPEEEIL--GSD------DEEQEDPADYCKGGYHPVKIGDLFNSHYHVIRKLGWGHFST 110

  Fly   361 VWLCRDLKDEKYVALKVVKSAPHYIETAADEIRLLEAIRDADPMDVKRERIVRLMNHFTVRGVNG 425
            ||||.|::.:::||:||||||.||.|||.|||:||..:|:.||.|..::.:|:|::.|.:.||||
Zfish   111 VWLCWDIQGKRFVAMKVVKSAQHYTETALDEIKLLRCVRETDPEDPNKDMVVQLIDDFKISGVNG 175

  Fly   426 MHTCLVFEALGCSLYKLIVKNNYQGLAIAQVRNIIRQVLEGLDYLHSKCSIIHTDIKPENILLVI 490
            :|.|:|||.||..|.|.|:|:|||||.:..|::||||||:|||||||||.||||||||||||:.:
Zfish   176 IHVCMVFEVLGHHLLKWIIKSNYQGLPLPCVKSIIRQVLQGLDYLHSKCKIIHTDIKPENILMCV 240

  Fly   491 DNAAAMNQQIDDEINSLRVKGVDFPDS-------------------------------------- 517
            |:|......:  |....:..|...|..                                      
Zfish   241 DDAFVRRMAV--EATEWQKAGAPPPSGSAVSTAPQLKQVGKISKNKKKKMKKKQKRQAELLERRM 303

  Fly   518 -YISSIEKQT-KSRAKWPLIEPNGST--------------------------------------- 541
             .|.::|::. |.||....|..:|.|                                       
Zfish   304 LEIEALEREAEKQRADGETIAEHGPTLADSEEDEEEEEDEEEEEKQRPVRLTNHTCAEPEQPEVE 368

  Fly   542 --------NTNTNTSNSTATNSNSSTPLAAVIMSTLDKEDTTTTTSSTLNSNTTSSLASKYSSLL 598
                    :|:|:|...|.|::.:.||     ..|..:..|.|.|.:..:::|.:......:...
Zfish   369 DSDDGEESHTHTHTPTHTPTHTATHTP-----THTPTETPTQTPTHTPTHAHTPTHTPLGRTDTP 428

  Fly   599 GDSECNGG---LGGSANINNRYRTEKKI------------TAKSSGDCDEDAESDTLGEQSTLAS 648
            .:.|.:||   |.||.  :.|...|:|.            ||.:..:..|:.....:.|......
Zfish   429 QEPERSGGAEELDGSG--DGRQEEEEKAEEVEKAEEVEEETAAAPSESTEEETRQCVKEDEQTKH 491

  Fly   649 TMDSPTDLDPEPELDSKPNTVPEPSEGPIPEQPTPNSTN-------SSCPSHNTATIAKSKINSN 706
            |.|:..:.:.|.|.|.:.:...|..|....||.|...||       ..|.|....|:....:.|.
Zfish   492 TRDTQDEEEEEEEEDDEEDEEDEEEEEEEEEQSTAAKTNGHVCVCVQECVSPAAPTLLCPLVESE 556

  Fly   707 ILSTCTSLTSTNEYCFTNTNTTTASTPSAPPSATPSSAPALASATPPSTCTPSFTQIAPSATAPA 771
            | ||.....|...|...|.:|::.|..:.....|| ..|.|     |....|:.| :...|..|.
Zfish   557 I-STTDRDASDASYELFNGDTSSLSNGARHRGTTP-RFPEL-----PLDPDPTHT-LQDQAQGPD 613

  Fly   772 TSTTCTTSAEFYDGDHKTTSTSTTTTSNAISSATTTTATTTTAIAKLNVHANAIPSQNQSQSSQN 836
            ..:           |...|.:|::|..|           ....|...::..|.:..:|...    
Zfish   614 RHS-----------DRSRTVSSSSTGDN-----------PKARIRAADLLVNPLDPRNAEA---- 652

  Fly   837 NTYTIQSLIDNSNVRVKIADLGNACYDYHHFTEDIQTRQYRSIEVLLGAPYNYTADIWSTACLAF 901
                         :|||||||||||:.:.|||||||||||||||||:||.|:..||||||||:||
Zfish   653 -------------LRVKIADLGNACWVHKHFTEDIQTRQYRSIEVLIGAGYSTPADIWSTACMAF 704

  Fly   902 ELATGDYLFDPHAGESYSRDEDHLAHIVELLGSIPQSVIFRGKHGLKYFTSYGSLRNITKLKPWS 966
            |||||||||:||:||.|||||||:|||:||||.||:.....||:..::|...|.||:||||||||
Zfish   705 ELATGDYLFEPHSGEDYSRDEDHIAHIIELLGCIPRHFALSGKYSREFFNRRGELRHITKLKPWS 769

  Fly   967 LMNVLVEKYDWDPVEAKKFSDFLLPMLEYNPVIRASAAECLQHPWL 1012
            |.:||||||.|...||..|:.|||||||..|..||||:|||.||||
Zfish   770 LFDVLVEKYGWAAEEAGHFTHFLLPMLEMVPEKRASASECLHHPWL 815

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Srpk79DNP_001246881.1 STKc_SRPK 336..>504 CDD:271038 98/168 (58%)
S_TKc 347..>492 CDD:214567 90/145 (62%)
STKc_SRPK <844..1012 CDD:271038 113/168 (67%)
srpk2XP_021326235.1 PKc_like 84..>274 CDD:328722 102/192 (53%)
PKc_like <637..815 CDD:328722 115/195 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1290
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D290680at2759
OrthoFinder 1 1.000 FOG0000435
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127107
Panther 1 1.100 O PTHR24055
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
65.870

Return to query results.
Submit another query.