DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Srpk79D and LOC100144966

Sequence 1:NP_001246881.1 Gene:Srpk79D FlyBaseID:FBgn0025702 Length:1018 Species:Drosophila melanogaster
Sequence 2:NP_001120004.1 Gene:LOC100144966 XenbaseID:XB-GENE-5772074 Length:398 Species:Xenopus tropicalis

Alignment Length:712 Identity:189/713 (27%)
Similarity:269/713 (38%) Gaps:321/713 (45%)


  Fly   306 EIYPDSSDSSLYVSDEE--QEDASQYCRGGYHPVVIGDIFDNRFRVVRKLGWGHFSTVWLCRDLK 368
            :::...|..|..::|::  |||.::||.||||||..||:.:.|::.:.|:|||:|||||||.||:
 Frog     3 QVFGFKSKKSFAMTDKDGWQEDPAEYCPGGYHPVQAGDMLNRRYQAIHKVGWGYFSTVWLCHDLQ 67

  Fly   369 DEKYVALKVVKSAPHYIETAADEIRLLEAIRDADPMDVKRERIVRLMNHFTVRGVNGMHTCLVFE 433
            .:|.||:|:.||...:.|.|.|||.:|..:..|...:.:.|.:::|::.|.:.|.||:|.|||||
 Frog    68 KKKKVAVKISKSGRRFSEAALDEISILNCVNGARKKESQGENVIQLLDDFKLIGENGLHVCLVFE 132

  Fly   434 ALGCSLYKLIVKNNYQGLAIAQVRNIIRQVLEGLDYLHSKCSIIHTDIKPENILLVI--DNAAAM 496
            .||.||..|:..:..:||.:..||.:::|||:||::||.:|.||||||||||||:.:  ||.   
 Frog   133 LLGPSLLHLMRNHGSEGLPLTCVRRVLQQVLQGLNFLHKRCRIIHTDIKPENILVCVKADNL--- 194

  Fly   497 NQQIDDEINSLRVKGVDFPDSYISSIEKQTKSRAKWPLIEPNGSTNTNTNTSNSTATNSNSSTPL 561
             ||...|                ::|..|.|:                                 
 Frog   195 -QQCMAE----------------ATIWSQNKA--------------------------------- 209

  Fly   562 AAVIMSTLDKEDTTTTTSSTLNSNTTSSLASKYSSLLGDSECNGGLGGSANINNRYRTEKKITAK 626
                                                 ||                 |||:.:...
 Frog   210 -------------------------------------GD-----------------RTEQGVDVN 220

  Fly   627 SSGDCDEDAESDTLGEQSTLASTMDSPTDLDPEPELDSKPNTVPEPSEGPIPEQPTPNSTNSSCP 691
            ......|...||.||                                                  
 Frog   221 FLTHLFESGNSDMLG-------------------------------------------------- 235

  Fly   692 SHNTATIAKSKINSNILSTCTSLTSTNEYCFTNTNTTTASTPSAPPSATPSSAPALASATPPSTC 756
                                                                             
 Frog   236 ----------------------------------------------------------------- 235

  Fly   757 TPSFTQIAPSATAPATSTTCTTSAEFYDGDHKTTSTSTTTTSNAISSATTTTATTTTAIAKLNVH 821
                                                                             
 Frog   236 ----------------------------------------------------------------- 235

  Fly   822 ANAIPSQNQSQSSQNNTYTIQSLIDNSNVRVKIADLGNACYDYHHFTEDIQTRQYRSIEVLLGAP 886
                                          |||||||::|:.|..|:|:|||:|||::|||||:.
 Frog   236 ------------------------------VKIADLGSSCWTYKAFSEEIQTQQYRALEVLLGST 270

  Fly   887 YNYTADIWSTACLAFELATGDYLFDPHAGESYSRDEDHLAHIVELLGSIPQSVIFRGKHGLKYFT 951
            |:...|||||||:|||:||..|||:||||::::|::||:|.|:||||.||..||..|:....:|.
 Frog   271 YSTPVDIWSTACMAFEMATSYYLFEPHAGKTFTREDDHIACIMELLGRIPPKVISSGRKSPAFFN 335

  Fly   952 SYGSLRNITKLKPWSLMNVLVEKYDWDPVEAKKFSDFLLPMLEYNPVIRASAAECLQHPWLE 1013
            ..|.|..|.:|.|..|.:.||.::.|...||..|:.||||||||....||:|..|||||||:
 Frog   336 KQGDLLRIPQLYPCGLYDTLVRRHRWQKNEALTFASFLLPMLEYVSEKRATAETCLQHPWLQ 397

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Srpk79DNP_001246881.1 STKc_SRPK 336..>504 CDD:271038 77/170 (45%)
S_TKc 347..>492 CDD:214567 68/147 (46%)
STKc_SRPK <844..1012 CDD:271038 86/168 (51%)
LOC100144966NP_001120004.1 STKc_SRPK 35..396 CDD:271038 176/678 (26%)
S_TKc 46..396 CDD:214567 171/667 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1290
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D290680at2759
OrthoFinder 1 1.000 FOG0000435
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
43.870

Return to query results.
Submit another query.