DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Srpk79D and srpk3

Sequence 1:NP_001246881.1 Gene:Srpk79D FlyBaseID:FBgn0025702 Length:1018 Species:Drosophila melanogaster
Sequence 2:NP_001096432.2 Gene:srpk3 XenbaseID:XB-GENE-1010990 Length:698 Species:Xenopus tropicalis

Alignment Length:778 Identity:297/779 (38%)
Similarity:406/779 (52%) Gaps:134/779 (17%)


  Fly   264 KAQQDFLSLSLSPPLNRRRDMPALRGPFVSLSEPRGTLSTTDEIYPDSSDSSLYVSDEEQEDASQ 328
            :|||...|....||            |...|.||..         |::.:..|...||||||.:.
 Frog    24 EAQQTVPSAPPPPP------------PPPPLPEPSP---------PEAEEEILGSDDEEQEDPAD 67

  Fly   329 YCRGGYHPVVIGDIFDNRFRVVRKLGWGHFSTVWLCRDLKDEKYVALKVVKSAPHYIETAADEIR 393
            ||:||||||.|||:|:.|:.|:||||||||||||||.|::.:::||:||||||.||.|||.|||:
 Frog    68 YCKGGYHPVKIGDLFNGRYHVIRKLGWGHFSTVWLCWDMQGKRFVAMKVVKSAQHYTETALDEIK 132

  Fly   394 LLEAIRDADPMDVKRERIVRLMNHFTVRGVNGMHTCLVFEALGCSLYKLIVKNNYQGLAIAQVRN 458
            ||..:|::||.|..::.:|:|::.|.:.|:||||.|:|||.||..|.|.|:|:|||||.|..|::
 Frog   133 LLRCVRESDPRDPNKDMVVQLIDDFKISGMNGMHVCMVFEVLGHHLLKWIIKSNYQGLPIRCVKS 197

  Fly   459 IIRQVLEGLDYLHSKCSIIHTDIKPENILLVIDNAAAMNQQIDDEINSLRVKGVDFPDSYISSIE 523
            ||||||:|||||||||.||||||||||||:.:::|..  :::..|....:..|...|.....|..
 Frog   198 IIRQVLQGLDYLHSKCKIIHTDIKPENILMCVEDAYV--RRMAAEATEWQKAGAPPPSGSAVSTA 260

  Fly   524 KQTKSRAKWPLIEPNGSTNTNTNTSNSTATNSNSSTPLAAVIMSTL----------DKEDTTTTT 578
            .|.|         |.|..:.|............     |.::...|          :::....|.
 Frog   261 PQQK---------PIGKISKNKKKKLKKKQKRQ-----AELLEKRLQEIEELEREAERKKAEETV 311

  Fly   579 SSTLNSNTTSSLASKYSSLLGDSECNGG---------LGGSANINNRYRTEKKITAKSSGDCDED 634
            |||:              ||.:.:..|.         |..:|:       |:.:.....||.|| 
 Frog   312 SSTI--------------LLNEQDLEGHPEAKMKSVCLEDAAD-------EEPVNEYERGDNDE- 354

  Fly   635 AESDTLGEQSTLASTMDSPTDLDPEPEL-DSKPNTVPEP------SEGPI---PEQPTPNSTNSS 689
             :.||  |:..:....:...|.|.|||| |:....:..|      ..||.   |:.......:..
 Frog   355 -KEDT--EKENIEKDDEDEDDDDAEPELVDTDQTWIESPKTNGHLENGPFSVEPQLEDEEDEDDD 416

  Fly   690 CPSHNTATIAKSKINSNILSTCTSLTSTNEYCFTNTNTTTASTPSAPPSATPSSAPALASATPPS 754
            |.:.....:.:|.:.|:       .|.::.|...|.........::....:..||.....|...:
 Frog   417 CLNPEEFNLDESNVESD-------YTYSSSYEQFNGELPNGQHKNSELQFSEFSASVFPEALESA 474

  Fly   755 TCTPSFTQIAPSATAPATSTTCTTSAEFYDGDHKTTSTSTTTTSNAISSATTTTATTTTAIAKLN 819
            .|     .:|.|..:..|           |.|.   |:|....|..:|:::|.....|:.:...:
 Frog   475 AC-----GLAISEDSALT-----------DRDE---SSSCHDRSRTVSASSTGDLPKTSKMRAAD 520

  Fly   820 VHANAIPSQNQSQSSQNNTYTIQSLIDNSNVRVKIADLGNACYDYHHFTEDIQTRQYRSIEVLLG 884
            :..|.:..:|..:                 :|||||||||||:.:.|||||||||||||||||:|
 Frog   521 LLVNPLDPRNADK-----------------IRVKIADLGNACWVHKHFTEDIQTRQYRSIEVLIG 568

  Fly   885 APYNYTADIWSTACLAFELATGDYLFDPHAGESYSRDEDHLAHIVELLGSIPQSVIFRGKHGLKY 949
            |.|:..||||||||:|||||||||||:||:||.|||||||:|||:||||:||:.....||:..::
 Frog   569 AGYSTPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIAHIIELLGNIPRHFALSGKYSREF 633

  Fly   950 FTSYGSLRNITKLKPWSLMNVLVEKYDWDPVEAKKFSDFLLPMLEYNPVIRASAAECLQHPWL 1012
            |...|.||:|||||||||.:||||||.|...:|.:|:|||.||||..|..||||.|||:||||
 Frog   634 FNRRGELRHITKLKPWSLFDVLVEKYGWPQEDAAQFTDFLTPMLEMVPEKRASAGECLRHPWL 696

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Srpk79DNP_001246881.1 STKc_SRPK 336..>504 CDD:271038 99/168 (59%)
S_TKc 347..>492 CDD:214567 90/145 (62%)
STKc_SRPK <844..1012 CDD:271038 112/168 (67%)
srpk3NP_001096432.2 PKc_like 73..>261 CDD:304357 104/190 (55%)
S_TKc 86..>227 CDD:214567 90/141 (64%)
PKc_like <518..696 CDD:304357 114/195 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1290
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D290680at2759
OrthoFinder 1 1.000 FOG0000435
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.880

Return to query results.
Submit another query.