DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Srpk79D and srpk2

Sequence 1:NP_001246881.1 Gene:Srpk79D FlyBaseID:FBgn0025702 Length:1018 Species:Drosophila melanogaster
Sequence 2:NP_001096257.1 Gene:srpk2 XenbaseID:XB-GENE-990797 Length:637 Species:Xenopus tropicalis

Alignment Length:748 Identity:275/749 (37%)
Similarity:379/749 (51%) Gaps:158/749 (21%)


  Fly   271 SLSLSP--PLNRRRDMPALRG----PFVSLSEPRGTLSTTDEIYPDSSDSSLYVSDEEQEDASQY 329
            ||...|  |.:..:|:|...|    |...:..|.|.|.:               .:|||||...|
 Frog    40 SLDSQPGLPEHSLQDVPLSPGPPPTPPTPVLPPPGPLGS---------------DNEEQEDPGDY 89

  Fly   330 CRGGYHPVVIGDIFDNRFRVVRKLGWGHFSTVWLCRDLKDEKYVALKVVKSAPHYIETAADEIRL 394
            |||||:||.|||:|:.|:.||||||||||||||||.||:.:::|||||||||.||.|||.|||:|
 Frog    90 CRGGYYPVKIGDLFNGRYHVVRKLGWGHFSTVWLCWDLQRKRFVALKVVKSAVHYTETALDEIKL 154

  Fly   395 LEAIRDADPMDVKRERIVRLMNHFTVRGVNGMHTCLVFEALGCSLYKLIVKNNYQGLAIAQVRNI 459
            |:.:||:||.|.|||.||:|::.|.:.||||:|.|:|.|.||..|.|.|:|:||:|:.:..|::|
 Frog   155 LKCVRDSDPSDSKREMIVQLIDDFKISGVNGVHICMVLEVLGHQLLKWIIKSNYEGVPLPCVKSI 219

  Fly   460 IRQVLEGLDYLHSKCSIIHTDIKPENILLVIDNAAAMNQQIDDEINSLRVKGVDFPDSYISSIEK 524
            :||||:||||||:||.||||||||||||:.::                        :.||..:..
 Frog   220 LRQVLQGLDYLHTKCKIIHTDIKPENILMCVE------------------------EGYIRRLAA 260

  Fly   525 QTKSRAKWPLIEPNGSTNTNTNTSNSTATNSNSSTPLAAVIMSTLDKEDTTTTTSSTLNSNTTSS 589
            :.....:..:..|:||.     .|::..::.|.:..::......|.::          .......
 Frog   261 EATIWQQSGMPPPSGSA-----VSSAPPSHQNLNGKVSKNKKKKLKRQ----------QKRQQKL 310

  Fly   590 LASKYSSLLGDSECNGGLGGSANINNRYRTEKKITAKSSGDCDEDAESDTLGEQSTLASTMDSPT 654
            |..:...:....|..|| ....||.:.              |:........|:||:..:.:.|  
 Frog   311 LEERLRDIHNMEELGGG-DSCPNIQHH--------------CNPGNHEQHWGQQSSQETAVKS-- 358

  Fly   655 DLDPEPELDSKPNTVPEPSEGPIPEQPTPNSTNSSCPSHNTATIAKSKINSNILSTCTSLTSTNE 719
                    :|....:..|......:|   ...:||..|..|..:|:|..::.:..:|      |.
 Frog   359 --------ESTSQLISNPISSTTGDQ---ECADSSLGSGGTTCLAQSPQSTGLYKSC------NG 406

  Fly   720 YCFTNTNTTTASTPSAPPSATPSSAPALASATPPSTCTPSFTQIAPSATAPATSTTCTTSAEFYD 784
            |                .|.|..|:        |.|.|..|:..|.||          ||.....
 Frog   407 Y----------------SSGTRGSS--------PDTHTSGFSSSALSA----------TSGSAIS 437

  Fly   785 GDHKTTSTSTTTTSNAISSATTTTATTTTAIAKLNVHANAIPSQNQSQSSQNNTYTIQSLIDNSN 849
            |...........:.|.:..|.             :...|.:..||..:                 
 Frog   438 GYSGVRGRGGILSPNLLFCAA-------------DFLVNPLDPQNADK----------------- 472

  Fly   850 VRVKIADLGNACYDYHHFTEDIQTRQYRSIEVLLGAPYNYTADIWSTACLAFELATGDYLFDPHA 914
            ::||||||||||:.:.||||||||||||::|||:||.|...||||||||:|||||||||||:||:
 Frog   473 IQVKIADLGNACWVHKHFTEDIQTRQYRALEVLIGAGYGTPADIWSTACMAFELATGDYLFEPHS 537

  Fly   915 GESYSRDEDHLAHIVELLGSIPQSVIFRGKHGLKYFTSYGSLRNITKLKPWSLMNVLVEKYDWDP 979
            ||.|:|||||:|||:||||.||......|::..:||:..|.||:|..||.|.|.:||||||:|..
 Frog   538 GEDYTRDEDHIAHIIELLGDIPPHFALSGRYSREYFSRRGELRHIQNLKHWGLFDVLVEKYEWSL 602

  Fly   980 VEAKKFSDFLLPMLEYNPVIRASAAECLQHPWL 1012
            .||.:|:|||:||||:.|..||:|::|||||||
 Frog   603 EEATQFTDFLMPMLEFLPEKRATASQCLQHPWL 635

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Srpk79DNP_001246881.1 STKc_SRPK 336..>504 CDD:271038 99/168 (59%)
S_TKc 347..>492 CDD:214567 92/145 (63%)
STKc_SRPK <844..1012 CDD:271038 104/168 (62%)
srpk2NP_001096257.1 STKc_SRPK3 96..635 CDD:271120 252/676 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1290
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D290680at2759
OrthoFinder 1 1.000 FOG0000435
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
54.880

Return to query results.
Submit another query.