DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and AT5G23240

DIOPT Version :10

Sequence 1:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_197715.1 Gene:AT5G23240 / 832388 AraportID:AT5G23240 Length:465 Species:Arabidopsis thaliana


Alignment Length:132 Identity:38/132 - (28%)
Similarity:50/132 - (37%) Gaps:29/132 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 STSGDS------LYEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILS 70
            :||..|      ||::||:.:::....||..||.|..:.|||...|  ...|....:|.|:.:||
plant    39 ATSSSSSITDFDLYDLLGIDRSSDKSQIKSAYRALQKRCHPDIAGD--PGHDMAIILNEAYQLLS 101

  Fly    71 DQTKRNIYD----------NYGSLGLYIAEQFGEENVNAYFVVTSPAVKAVVICCAVITGCCCCC 125
            |...|..||          .|....:|......|....|.||   ..||.|        ||..|.
plant   102 DPISRQAYDKEQAKLEELRGYTGKPIYSVWCGPETEQRAAFV---DEVKCV--------GCLKCA 155

  Fly   126 CC 127
            .|
plant   156 LC 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_730713.1 DnaJ 17..79 CDD:395170 21/67 (31%)
AT5G23240NP_197715.1 DnaJ 50..110 CDD:395170 20/61 (33%)
Fer4_13 143..197 CDD:433153 8/26 (31%)

Return to query results.
Submit another query.