DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and J11

DIOPT Version :10

Sequence 1:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_195328.1 Gene:J11 / 829760 AraportID:AT4G36040 Length:161 Species:Arabidopsis thaliana


Alignment Length:99 Identity:34/99 - (34%)
Similarity:52/99 - (52%) Gaps:15/99 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RKLSTSGDSLYEILGLPKTATGDDIKKTYRKLALKYHPD---KNPDNVDAADKFKEVNRAHSILS 70
            |:|:|...|||::|.:|..||..|||..||:||...|||   .:..:..:||:|.:::.|:..||
plant    57 RRLTTVPASLYDVLEVPLGATSQDIKSAYRRLARICHPDVAGTDRTSSSSADEFMKIHAAYCTLS 121

  Fly    71 DQTKRNIYD------------NYGSLGLYIAEQF 92
            |..||::||            ....||.|:...:
plant   122 DPEKRSVYDRRMLRRSRPLTVGTSGLGSYVGRNW 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_730713.1 DnaJ 17..79 CDD:395170 26/64 (41%)
J11NP_195328.1 DnaJ 65..130 CDD:395170 26/64 (41%)

Return to query results.
Submit another query.