DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and ATERDJ3B

DIOPT Version :10

Sequence 1:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_191819.1 Gene:ATERDJ3B / 825434 AraportID:AT3G62600 Length:346 Species:Arabidopsis thaliana


Alignment Length:79 Identity:42/79 - (53%)
Similarity:56/79 - (70%) Gaps:3/79 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SGDSLYEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQTKRNIY 78
            :|.|.|::|.:||.|:.:.||:.|||||||||||||..|.:|..||.|:|.|:.:|||:.||.||
plant    23 AGKSYYDVLQVPKGASDEQIKRAYRKLALKYHPDKNQGNEEATRKFAEINNAYEVLSDEEKREIY 87

  Fly    79 DNYGSLGLYIAEQF 92
            :.||..||   :||
plant    88 NKYGEEGL---KQF 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_730713.1 DnaJ 17..79 CDD:395170 34/61 (56%)
ATERDJ3BNP_191819.1 DnaJ_bact 26..343 CDD:274090 41/76 (54%)

Return to query results.
Submit another query.