DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and DNAJB14

DIOPT Version :10

Sequence 1:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001026893.1 Gene:DNAJB14 / 79982 HGNCID:25881 Length:379 Species:Homo sapiens


Alignment Length:104 Identity:40/104 - (38%)
Similarity:54/104 - (51%) Gaps:25/104 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SAPGMDKRKLSTSGD--------------------SLYEILGLPKTATGDDIKKTYRKLALKYHP 46
            |.|...|...|.||:                    :.||:||:.|.|..:|:||.|||||||:||
Human    73 SKPNCTKDSTSGSGEGGKGYTKDQVDGVLSINKCKNYYEVLGVTKDAGDEDLKKAYRKLALKFHP 137

  Fly    47 DKN--PDNVDAADKFKEVNRAHSILSDQTKRNIYDNYGS 83
            |||  |   .|.|.||::..|:::||:..||..||..|:
Human   138 DKNHAP---GATDAFKKIGNAYAVLSNPEKRKQYDLTGN 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_730713.1 DnaJ 17..79 CDD:395170 31/63 (49%)
DNAJB14NP_001026893.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 55..94 6/20 (30%)
DnaJ_bact 109..>214 CDD:274090 34/68 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 219..241
DUF1977 271..369 CDD:462754
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.