DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and Dnaja4

DIOPT Version :10

Sequence 1:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001344804.1 Gene:Dnaja4 / 58233 MGIID:1927638 Length:426 Species:Mus musculus


Alignment Length:75 Identity:38/75 - (50%)
Similarity:53/75 - (70%) Gaps:9/75 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SGDSL------YEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQ 72
            :||.:      |:|||:..:|:.::|||.|||||||||||||||.   .:|||.:::|:.:|||.
Mouse    26 NGDKMVKETQYYDILGVKPSASPEEIKKAYRKLALKYHPDKNPDE---GEKFKLISQAYEVLSDP 87

  Fly    73 TKRNIYDNYG 82
            .||:|||..|
Mouse    88 KKRDIYDQGG 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_730713.1 DnaJ 17..79 CDD:395170 33/67 (49%)
Dnaja4NP_001344804.1 PTZ00037 15..423 CDD:240236 38/75 (51%)

Return to query results.
Submit another query.