DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and Dnajc4

DIOPT Version :10

Sequence 1:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001343928.1 Gene:Dnajc4 / 57431 MGIID:1927346 Length:261 Species:Mus musculus


Alignment Length:62 Identity:21/62 - (33%)
Similarity:38/62 - (61%) Gaps:0/62 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQTKRNIYDN 80
            ||:||:...|:.::||:.:...:.:.|||::|.|.....:|.|:|.|:.:||.:..|..||:
Mouse    55 YELLGVHPGASAEEIKRAFFTKSKELHPDRDPGNPALHSRFVELNEAYRVLSREESRRNYDH 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_730713.1 DnaJ 17..79 CDD:395170 19/59 (32%)
Dnajc4NP_001343928.1 DnaJ 53..>157 CDD:440252 21/62 (34%)

Return to query results.
Submit another query.