DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and DNAJC12

DIOPT Version :10

Sequence 1:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_068572.1 Gene:DNAJC12 / 56521 HGNCID:28908 Length:198 Species:Homo sapiens


Alignment Length:70 Identity:21/70 - (30%)
Similarity:42/70 - (60%) Gaps:0/70 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 STSGDSLYEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQTKRN 76
            |...:..|.:||..:.::.:.|...::..||:.||||:|:|..|.:.|:::.:|..||:::..|.
Human     9 SEDTEDYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVETFQKLQKAKEILTNEESRA 73

  Fly    77 IYDNY 81
            .||::
Human    74 RYDHW 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_730713.1 DnaJ 17..79 CDD:395170 18/61 (30%)
DNAJC12NP_068572.1 DnaJ 14..76 CDD:395170 18/61 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 114..169
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.