DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and dnajb14

DIOPT Version :10

Sequence 1:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001016588.1 Gene:dnajb14 / 549342 XenbaseID:XB-GENE-952313 Length:375 Species:Xenopus tropicalis


Alignment Length:67 Identity:33/67 - (49%)
Similarity:45/67 - (67%) Gaps:5/67 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YEILGLPKTATGDDIKKTYRKLALKYHPDKN--PDNVDAADKFKEVNRAHSILSDQTKRNIYDNY 81
            ||:||:...|..:|:||.|||||||:|||||  |   .|.:.||::..|:::||:..||..||..
 Frog   108 YEVLGVSTDAGEEDLKKAYRKLALKFHPDKNHAP---GATEAFKKIGNAYAVLSNPEKRKQYDLT 169

  Fly    82 GS 83
            ||
 Frog   170 GS 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_730713.1 DnaJ 17..79 CDD:395170 29/61 (48%)
dnajb14NP_001016588.1 FliS 6..>34 CDD:469861
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..95
DnaJ_bact 107..>212 CDD:274090 33/67 (49%)
DUF1977 264..365 CDD:462754
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.