DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and Dnajb14

DIOPT Version :10

Sequence 1:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_001102663.2 Gene:Dnajb14 / 499716 RGDID:1591949 Length:377 Species:Rattus norvegicus


Alignment Length:104 Identity:40/104 - (38%)
Similarity:54/104 - (51%) Gaps:25/104 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SAPGMDKRKLSTSGD--------------------SLYEILGLPKTATGDDIKKTYRKLALKYHP 46
            |.|...|...|.:|:                    :.||:||:.|.|..:|:||.|||||||:||
  Rat    73 SKPSFGKDGTSGAGEGGKVYTKDQVEGVLSINKCKNYYEVLGVTKDAGDEDLKKAYRKLALKFHP 137

  Fly    47 DKN--PDNVDAADKFKEVNRAHSILSDQTKRNIYDNYGS 83
            |||  |   .|.|.||::..|:::||:..||..||..||
  Rat   138 DKNHAP---GATDAFKKIGNAYAVLSNPEKRKQYDLTGS 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_730713.1 DnaJ 17..79 CDD:395170 31/63 (49%)
Dnajb14NP_001102663.2 DnaJ_bact 109..>214 CDD:274090 35/68 (51%)
DUF1977 271..367 CDD:462754
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.