DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and DNAJB9

DIOPT Version :10

Sequence 1:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_036460.1 Gene:DNAJB9 / 4189 HGNCID:6968 Length:223 Species:Homo sapiens


Alignment Length:73 Identity:35/73 - (47%)
Similarity:48/73 - (65%) Gaps:1/73 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 KLSTSGDSLYEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQTK 74
            :|..:..|.|:|||:||:|:...|||.:.|||:||||||| .:.||..||:|:..|:..|||..:
Human    19 ELILASKSYYDILGVPKSASERQIKKAFHKLAMKYHPDKN-KSPDAEAKFREIAEAYETLSDANR 82

  Fly    75 RNIYDNYG 82
            |..||..|
Human    83 RKEYDTLG 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_730713.1 DnaJ 17..79 CDD:395170 31/61 (51%)
DNAJB9NP_036460.1 type 2 signal-anchor for ER localization 7..23 1/3 (33%)
DnaJ_bact 26..>136 CDD:274090 34/66 (52%)
Divergent targeting domain. /evidence=ECO:0000250|UniProtKB:Q9QYI6 91..223 35/73 (48%)

Return to query results.
Submit another query.