DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and CG3061

DIOPT Version :10

Sequence 1:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_650328.1 Gene:CG3061 / 41707 FlyBaseID:FBgn0038195 Length:370 Species:Drosophila melanogaster


Alignment Length:135 Identity:50/135 - (37%)
Similarity:63/135 - (46%) Gaps:39/135 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SAPGMDK------RKLSTSGDSLYEILGLPKTATGDDIKKTYRKLALKYHPDKN--PDNVDAADK 58
            |||...|      ||:.|..| .||:||:.||||..:|||.|:||||:.|||||  |..|:|   
  Fly    86 SAPDYTKDQLEAVRKVKTCKD-YYEVLGVSKTATDSEIKKAYKKLALQLHPDKNKAPGAVEA--- 146

  Fly    59 FKEVNRAHSILSDQTKRNIYDNYG----------------SLGLYIAEQFG-----------EEN 96
            ||.:..|..:|:|..||..||.||                ..|.|...::|           ||.
  Fly   147 FKALGNAAGVLTDAEKRKNYDLYGINESHNGHGNNGGGHHGHGQYYNNEYGYSRGFQADISAEEL 211

  Fly    97 VNAYF 101
            .|.:|
  Fly   212 FNMFF 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_730713.1 DnaJ 17..79 CDD:395170 31/63 (49%)
CG3061NP_650328.1 DnaJ_bact 106..>220 CDD:274090 43/115 (37%)
DUF1977 264..364 CDD:462754
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.