DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and CG6693

DIOPT Version :10

Sequence 1:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_650052.1 Gene:CG6693 / 41346 FlyBaseID:FBgn0037878 Length:299 Species:Drosophila melanogaster


Alignment Length:101 Identity:29/101 - (28%)
Similarity:52/101 - (51%) Gaps:18/101 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LYEILGLPKTATGDDIKKTYRKLALKYHPDKNPD--NVDAADKFKEVNRAHSILSDQTKRNIYDN 80
            :|:::.|.:.|...::||.|.||:|..|||:.|:  ..::.:|||.:::.:.:|:|..||.:||.
  Fly    16 VYKLMELARGAGEKEVKKAYHKLSLLVHPDRVPEEQKAESTEKFKVLSKLYQVLTDTQKRALYDE 80

  Fly    81 YG----------------SLGLYIAEQFGEENVNAY 100
            .|                .|...|.:...||::|.|
  Fly    81 QGVIDDDDESESKLSSWLELWSKIFKPITEEDINNY 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_730713.1 DnaJ 17..79 CDD:395170 20/62 (32%)
CG6693NP_650052.1 DnaJ 15..79 CDD:395170 20/62 (32%)

Return to query results.
Submit another query.