DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and CG7556

DIOPT Version :10

Sequence 1:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_573354.1 Gene:CG7556 / 32902 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster


Alignment Length:107 Identity:32/107 - (29%)
Similarity:54/107 - (50%) Gaps:26/107 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SLYEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQTKRNIYD-- 79
            :.||.:|:.:||||.::|:.:|.|::..||||||.. ||..:|:.:...:.:|.|.::|..||  
  Fly    40 NFYEFMGINQTATGAEVKRAFRTLSIVLHPDKNPAE-DANIQFRNLVSIYEVLKDPSRREKYDRV 103

  Fly    80 ------NYGS----------LGLYIAEQFGEENVNAYFVVTS 105
                  |:.|          :|||       |.....|::|:
  Fly   104 LKEGMPNWKSALYYYRRMRKIGLY-------EGAFILFLITT 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_730713.1 DnaJ 17..79 CDD:395170 22/61 (36%)
CG7556NP_573354.1 DnaJ 40..101 CDD:395170 22/61 (36%)
SANT 304..341 CDD:238096
SANT 400..447 CDD:238096
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.