DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and CG7872

DIOPT Version :10

Sequence 1:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_573044.1 Gene:CG7872 / 32493 FlyBaseID:FBgn0030658 Length:333 Species:Drosophila melanogaster


Alignment Length:115 Identity:34/115 - (29%)
Similarity:58/115 - (50%) Gaps:23/115 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 DSLYEILGLPKTATGDDIKKTYRKLALKYHPD--KNPDNVDAAD-KFKEVNRAHSILSDQTKRNI 77
            ::.|::||:.:.::..:|.|.||:||.:||||  :..:...||: :||.|..|:.||.|:..|..
  Fly    30 ENCYDVLGVTRESSKSEIGKAYRQLARRYHPDLHRGAEAKAAAETQFKLVATAYEILRDEESRTD 94

  Fly    78 YDNYGSLGLYIAEQFGEENVNAYFV--------VTSPAVKAVVICCAVIT 119
            ||       |:.     :|.:||:.        ..:|.|...|:...|:|
  Fly    95 YD-------YML-----DNPDAYYAHYYRYYRRRVAPKVDVRVVIVVVLT 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_730713.1 DnaJ 17..79 CDD:395170 23/64 (36%)
CG7872NP_573044.1 DnaJ 31..169 CDD:440252 34/114 (30%)
DnaJ 31..96 CDD:395170 23/64 (36%)

Return to query results.
Submit another query.