DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and dnajb12a

DIOPT Version :10

Sequence 1:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_997824.1 Gene:dnajb12a / 324005 ZFINID:ZDB-GENE-030131-2725 Length:371 Species:Danio rerio


Alignment Length:66 Identity:34/66 - (51%)
Similarity:45/66 - (68%) Gaps:5/66 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YEILGLPKTATGDDIKKTYRKLALKYHPDKN--PDNVDAADKFKEVNRAHSILSDQTKRNIYDNY 81
            ||.||:.|.|:.:|:||.|||||||:|||||  |   .|.:.||.:..|:::||:..||..||.|
Zfish   110 YETLGVSKEASEEDLKKAYRKLALKFHPDKNHAP---GATEAFKAIGNAYAVLSNPEKRRQYDVY 171

  Fly    82 G 82
            |
Zfish   172 G 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_730713.1 DnaJ 17..79 CDD:395170 30/61 (49%)
dnajb12aNP_997824.1 DnaJ_bact 108..>210 CDD:274090 34/66 (52%)
DUF1977 263..361 CDD:462754
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.