DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and cwf23

DIOPT Version :10

Sequence 1:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_587857.2 Gene:cwf23 / 2539268 PomBaseID:SPCC10H11.02 Length:289 Species:Schizosaccharomyces pombe


Alignment Length:72 Identity:30/72 - (41%)
Similarity:48/72 - (66%) Gaps:2/72 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LSTSGDSL--YEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQT 73
            :::.|||:  ||:||:.:.|...:|.:.:||.:|||||||||::..||:||..:..|::.|.|..
pombe     1 MASEGDSIDYYELLGINEDAQDQEIHRAWRKTSLKYHPDKNPNDPKAAEKFHMLQLAYNALIDVQ 65

  Fly    74 KRNIYDN 80
            .|..||:
pombe    66 LRKAYDS 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_730713.1 DnaJ 17..79 CDD:395170 26/63 (41%)
cwf23NP_587857.2 DnaJ 9..135 CDD:440252 27/64 (42%)
DnaJ 9..71 CDD:395170 25/61 (41%)
RRM_SF 165..240 CDD:473069
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.