DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and dnj-1

DIOPT Version :10

Sequence 1:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_502122.1 Gene:dnj-1 / 178040 WormBaseID:WBGene00001019 Length:401 Species:Caenorhabditis elegans


Alignment Length:67 Identity:35/67 - (52%)
Similarity:44/67 - (65%) Gaps:5/67 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 YEILGLPKTATGDDIKKTYRKLALKYHPDK--NPDNVDAADKFKEVNRAHSILSDQTKRNIYDNY 81
            ||||.:.|.|:.|||:|.|||||||.||||  .|   .|.:.||.:..|:::|||..||..||.|
 Worm   139 YEILKIDKKASDDDIRKEYRKLALKLHPDKCRAP---HATEAFKALGNAYAVLSDTDKRRQYDQY 200

  Fly    82 GS 83
            |:
 Worm   201 GA 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_730713.1 DnaJ 17..79 CDD:395170 31/61 (51%)
dnj-1NP_502122.1 DnaJ_bact 137..>260 CDD:274090 35/67 (52%)
DUF1977 302..395 CDD:462754
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.