DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and Dnajc14

DIOPT Version :10

Sequence 1:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_446142.2 Gene:Dnajc14 / 114481 RGDID:620489 Length:703 Species:Rattus norvegicus


Alignment Length:76 Identity:28/76 - (36%)
Similarity:45/76 - (59%) Gaps:6/76 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 RKLSTSG---DSL--YEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSI 68
            |.|:.:|   |.|  :.:||:..||:..::||.||:||:..||||| .:..|.:.||.:..|..|
  Rat   431 RLLTMAGVPEDELNPFHVLGVEATASDIELKKAYRQLAVMVHPDKN-HHPRAEEAFKVLRAAWDI 494

  Fly    69 LSDQTKRNIYD 79
            :|:..:|..|:
  Rat   495 VSNPERRKEYE 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_730713.1 DnaJ 17..79 CDD:395170 23/63 (37%)
Dnajc14NP_446142.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..150
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 164..229
DnaJ 444..505 CDD:395170 22/61 (36%)
Jiv90 533..621 CDD:464360
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 622..643
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 659..703
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.