DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Csp and DNAJA2

DIOPT Version :10

Sequence 1:NP_730713.1 Gene:Csp / 40459 FlyBaseID:FBgn0004179 Length:249 Species:Drosophila melanogaster
Sequence 2:NP_005871.1 Gene:DNAJA2 / 10294 HGNCID:14884 Length:412 Species:Homo sapiens


Alignment Length:69 Identity:38/69 - (55%)
Similarity:52/69 - (75%) Gaps:3/69 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LYEILGLPKTATGDDIKKTYRKLALKYHPDKNPDNVDAADKFKEVNRAHSILSDQTKRNIYDNYG 82
            ||:|||:|..|:.:::||.|||||.:|||||||   :|.|||||::.|:.:||:..||.:||.||
Human     9 LYDILGVPPGASENELKKAYRKLAKEYHPDKNP---NAGDKFKEISFAYEVLSNPEKRELYDRYG 70

  Fly    83 SLGL 86
            ..||
Human    71 EQGL 74

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CspNP_730713.1 DnaJ 17..79 CDD:395170 32/60 (53%)
DNAJA2NP_005871.1 PTZ00037 4..412 CDD:240236 38/69 (55%)
CXXCXGXG motif 143..150
CXXCXGXG motif 159..166
CXXCXGXG motif 186..193
CXXCXGXG motif 202..209
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 365..412
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.