DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11523 and Gskip

Sequence 1:NP_649386.1 Gene:CG11523 FlyBaseID:FBgn0037156 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_848728.2 Gene:Gskip MGIID:1914037 Length:144 Species:Mus musculus

Alignment Length:116 Identity:35/117 (30%)
Similarity:58/117 (50%) Gaps:16/117 (14%)


  Fly    21 EANAIINDVKAHVAEICISSKLASDATQIYLNIRTIESATCCVQVSSRGFKIVSSQYDTIDEDSR 85
            ||.|::|||...|..:.:|..:.......|:|:.|.|....|::::..|.::|...:|.::    
Mouse    41 EAEAVVNDVLFAVNHMFVSKSMPCADDVAYINVETKERNRYCLELTEAGLRVVGYAFDQVE---- 101

  Fly    86 ISALLRNGQEQGDDEEEEIFETPYALLDKISPRYVESFGNQLCQQLRALQQ 136
                        |..:....||.|:|||.:||.|.|:|||.|.|:|.||::
Mouse   102 ------------DHLQTPYHETVYSLLDTLSPAYREAFGNALLQRLEALKR 140

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11523NP_649386.1 DUF727 18..134 CDD:283065 34/113 (30%)
GskipNP_848728.2 DUF727 38..138 CDD:283065 34/113 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C187302918
eggNOG 1 0.900 E1_KOG3965
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003052
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12490
Phylome 1 0.910 0.641 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3011
TreeFam 1 0.960
87.830

Return to query results.
Submit another query.