DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11523 and GSKIP

Sequence 1:NP_649386.1 Gene:CG11523 FlyBaseID:FBgn0037156 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001258833.1 Gene:GSKIP HGNCID:20343 Length:139 Species:Homo sapiens

Alignment Length:116 Identity:38/117 (32%)
Similarity:58/117 (50%) Gaps:16/117 (14%)


  Fly    21 EANAIINDVKAHVAEICISSKLASDATQIYLNIRTIESATCCVQVSSRGFKIVSSQYDTIDEDSR 85
            ||.|::|||...|..:.:|..|.......|:|:.|.|....|::::..|.|:|...:|.:|    
Human    36 EAEAVVNDVLFAVNNMFVSKSLRCADDVAYINVETKERNRYCLELTEAGLKVVGYAFDQVD---- 96

  Fly    86 ISALLRNGQEQGDDEEEEIFETPYALLDKISPRYVESFGNQLCQQLRALQQ 136
                        |..:....||.|:|||.:||.|.|:|||.|.|:|.||::
Human    97 ------------DHLQTPYHETVYSLLDTLSPAYREAFGNALLQRLEALKR 135

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11523NP_649386.1 DUF727 18..134 CDD:283065 37/113 (33%)
GSKIPNP_001258833.1 DUF727 33..133 CDD:310132 37/113 (33%)
Required for PRKAR2A interaction, contributes to a protective effect against H(2)O(2)-induced apoptosis. {ECO:0000269|PubMed:25920809} 41..45 3/4 (75%)
Interaction with GSK3B and acts as GSK3B inhibitor. {ECO:0000269|PubMed:16981698} 115..139 12/22 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C187305145
eggNOG 1 0.900 E1_KOG3965
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I5276
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1508955at2759
OrthoFinder 1 1.000 FOG0003052
OrthoInspector 1 1.000 T1074549
orthoMCL 1 0.900 OOG5_133163
Panther 1 1.100 LDO PTHR12490
Phylome 1 0.910 0.641 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3011
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.