DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11523 and gskip

Sequence 1:NP_649386.1 Gene:CG11523 FlyBaseID:FBgn0037156 Length:158 Species:Drosophila melanogaster
Sequence 2:XP_021322813.1 Gene:gskip ZFINID:ZDB-GENE-040426-2777 Length:147 Species:Danio rerio

Alignment Length:116 Identity:37/117 (32%)
Similarity:61/117 (52%) Gaps:16/117 (14%)


  Fly    21 EANAIINDVKAHVAEICISSKLASDATQIYLNIRTIESATCCVQVSSRGFKIVSSQYDTIDEDSR 85
            ||.|::|||...|:::.:|..|:|.....|:|:.|.|....|::::..|.::|...:|.::    
Zfish    45 EAEAVVNDVLFAVSDMHVSHNLSSGLDVAYINVETREGNRYCLELTEAGLRVVGHTFDKVN---- 105

  Fly    86 ISALLRNGQEQGDDEEEEIFETPYALLDKISPRYVESFGNQLCQQLRALQQ 136
                        |....:..||.|:|||.:||.|.|:|||.|.|:|..|:|
Zfish   106 ------------DGLSSQYHETVYSLLDSLSPGYREAFGNALLQRLERLKQ 144

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11523NP_649386.1 DUF727 18..134 CDD:283065 35/113 (31%)
gskipXP_021322813.1 DUF727 42..142 CDD:310132 35/113 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C187304528
eggNOG 1 0.900 E1_KOG3965
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 69 1.000 Inparanoid score I5238
OMA 1 1.010
OrthoDB 1 1.010 D1508955at2759
OrthoFinder 1 1.000 FOG0003052
OrthoInspector 1 1.000 T1053827
orthoMCL 1 0.900 OOG5_133163
Panther 1 1.100 LDO PTHR12490
Phylome 1 0.910 0.641 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3011
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1312.800

Return to query results.
Submit another query.