DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG11523 and CG14505

Sequence 1:NP_649386.1 Gene:CG11523 FlyBaseID:FBgn0037156 Length:158 Species:Drosophila melanogaster
Sequence 2:NP_001036558.1 Gene:CG14505 FlyBaseID:FBgn0034327 Length:119 Species:Drosophila melanogaster

Alignment Length:114 Identity:31/115 (27%)
Similarity:55/115 (48%) Gaps:16/115 (14%)


  Fly    12 EEQAFNCEDEANAIINDVKAHVAEICISSKLASDATQIYLNIRTIESATCCVQVSSRGFKIVSSQ 76
            :|..|:...||..:::..:.....:.::..|.......|:||||:|....|||:|..|::|||.:
  Fly     7 DENDFHALREAQRMVDSCQDFADHLIVAEFLPHCRGVAYINIRTLEQVIYCVQLSRAGYRIVSYE 71

  Fly    77 YDTI-DEDSRISALLRNGQEQGDDEEEEIFETPYALLDKISPRYVESFG 124
            :|.: ||.:..               :.::|:.:.||..|||.|.|.:|
  Fly    72 FDDVADEVANC---------------DTVYESAHQLLAGISPLYGEKYG 105

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG11523NP_649386.1 DUF727 18..134 CDD:283065 29/109 (27%)
CG14505NP_001036558.1 DUF727 15..116 CDD:283065 29/107 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C187299291
eggNOG 1 0.900 E1_KOG3965
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1508955at2759
OrthoFinder 1 1.000 FOG0003052
orthoMCL 1 0.900 OOG5_133163
Panther 1 1.100 P PTHR12490
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R3011
76.870

Return to query results.
Submit another query.